KEGG   Burkholderia glumae BGR1: bglu_2g08420Help
Entry
bglu_2g08420      CDS       T00905                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00260  Glycine, serine and threonine metabolism
bgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01130  Biosynthesis of antibiotics
bgl01230  Biosynthesis of amino acids
Module
bgl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_2g08420
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bglu_2g08420
Enzymes [BR:bgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bglu_2g08420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACR31256
UniProt: C5AH76
Position
2:1020931..1022124
Genome map
AA seq 397 aa AA seqDB search
MYNFPDEHGHFGPYGGVFVAETLIHALDELRGAYERFRDDPEFVAEYQRELKHFVGRPSP
IYHAQRWSEMLGGAQLYLKREDLNHTGAHKINNVIGQALLARRMGKRRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTHIESTFYIIGTVAGPHPYPMLVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTDVQLIGVEAAGDGLDTGRHAASLTGGSPGVLHGNRTYLLQDADGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHECCRIEGIIPALESSHAIAY
GAKLAPSLPKDKILLVNLSGRGDKDMHTVAERGGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaactttcctgatgagcacggccatttcggcccctatggcggcgtgttcgtcgcc
gaaacgctgatccacgcgctcgacgaactgcgcggcgcctacgagcgttttcgcgacgat
cccgaattcgtcgccgaataccagcgcgagctgaagcacttcgtcggccgcccttcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagctctacctgaagcgc
gaggacctgaaccacaccggcgcccacaagatcaacaacgtgatcggccaggcgctgctc
gcgcgccggatgggcaagcggcgcgtgatcgccgagacgggcgccggccagcacggcgtg
gccacggccaccatctgcgcgcgcttcggcatggagtgcgtggtctacatgggtgccgag
gacgtgcgccgtcaggcggccaacgtctaccgcatgaagctgctcggcgcgaccgtggtg
ccggtggagtcgggttcgcgcacgctgaaggacgcgctcaacgaggcgatgcgcgactgg
gtcacccacatcgagtcgaccttctacatcatcggcacggtggccggcccgcacccctat
ccgatgctggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccc
gagctggcggggcgccagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atggggatcttctatccgtacatcgacgacaccgacgtgcagctgatcggcgtcgaggcg
gccggcgacggcctcgacacggggcgccacgcggcctcgctgacgggcggcagccccggc
gtgctgcacggcaaccgcacctatctgctgcaggatgccgacggccagatcatcgagacg
cattcggtctcggcgggcctcgactatccgggcgtcggccccgaacacgcctggctcaag
gacagcggccgcgcgcagtacgtgccgatcaccgacgaggaggcgctgaaggcgttccac
gagtgctgccggatcgagggcatcatcccggccctcgagtcgagccatgcgatcgcctac
ggcgcgaagctcgccccgagcctgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcataccgtcgccgagcgcggcggcatcacgctctga

DBGET integrated database retrieval system