KEGG   Burkholderia glumae BGR1: bglu_2g08420Help
Entry
bglu_2g08420      CDS       T00905                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bgl  Burkholderia glumae BGR1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bglu_2g08420
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bglu_2g08420
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bglu_2g08420
Enzymes [BR:bgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bglu_2g08420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:1020931..1022124
Genome map
AA seq 397 aa AA seqDB search
MYNFPDEHGHFGPYGGVFVAETLIHALDELRGAYERFRDDPEFVAEYQRELKHFVGRPSP
IYHAQRWSEMLGGAQLYLKREDLNHTGAHKINNVIGQALLARRMGKRRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTHIESTFYIIGTVAGPHPYPMLVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTDVQLIGVEAAGDGLDTGRHAASLTGGSPGVLHGNRTYLLQDADGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHECCRIEGIIPALESSHAIAY
GAKLAPSLPKDKILLVNLSGRGDKDMHTVAERGGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaactttcctgatgagcacggccatttcggcccctatggcggcgtgttcgtcgcc
gaaacgctgatccacgcgctcgacgaactgcgcggcgcctacgagcgttttcgcgacgat
cccgaattcgtcgccgaataccagcgcgagctgaagcacttcgtcggccgcccttcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagctctacctgaagcgc
gaggacctgaaccacaccggcgcccacaagatcaacaacgtgatcggccaggcgctgctc
gcgcgccggatgggcaagcggcgcgtgatcgccgagacgggcgccggccagcacggcgtg
gccacggccaccatctgcgcgcgcttcggcatggagtgcgtggtctacatgggtgccgag
gacgtgcgccgtcaggcggccaacgtctaccgcatgaagctgctcggcgcgaccgtggtg
ccggtggagtcgggttcgcgcacgctgaaggacgcgctcaacgaggcgatgcgcgactgg
gtcacccacatcgagtcgaccttctacatcatcggcacggtggccggcccgcacccctat
ccgatgctggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccc
gagctggcggggcgccagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atggggatcttctatccgtacatcgacgacaccgacgtgcagctgatcggcgtcgaggcg
gccggcgacggcctcgacacggggcgccacgcggcctcgctgacgggcggcagccccggc
gtgctgcacggcaaccgcacctatctgctgcaggatgccgacggccagatcatcgagacg
cattcggtctcggcgggcctcgactatccgggcgtcggccccgaacacgcctggctcaag
gacagcggccgcgcgcagtacgtgccgatcaccgacgaggaggcgctgaaggcgttccac
gagtgctgccggatcgagggcatcatcccggccctcgagtcgagccatgcgatcgcctac
ggcgcgaagctcgccccgagcctgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcataccgtcgccgagcgcggcggcatcacgctctga

DBGET integrated database retrieval system