KEGG   Burkholderia glumae: bglu_2g08580Help
Entry
bglu_2g08580      CDS       T00905                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgl  Burkholderia glumae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    bglu_2g08580
   00052 Galactose metabolism
    bglu_2g08580
   00500 Starch and sucrose metabolism
    bglu_2g08580
   00520 Amino sugar and nucleotide sugar metabolism
    bglu_2g08580
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     bglu_2g08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1041735..1042622
Genome map
AA seq 295 aa AA seqDB search
MLKVKKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKDKLLELVRGIKPSHVDCYYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFNHYHSSVIGVETIAREHSRSYGVVEGREWE
EDVIKLSGIVEKPAPEHAPSNLGVVGRYVLMPSVFDHLRRIRPGAGGELQLTDAVQSLLT
EEQVLAYRYYGTRFDCGSKLGYLKATVELALEHPEVGREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcaagaaggccgtgtttcccgttgccgggctgggcacgcggttcctgccg
gcgaccaaggccagcccgaaggaaatgctgcccgtggtggacaagccgctgatccagtac
gcggtggaggaggcgatcaacgccggcatcaccgagatgatcttcgtgaccgggcgcagc
aagcgcgcgatcgaggatcatttcgacaagtcctacgagatcgaggcggaactcgaggcg
cgcggcaaggacaagctgctcgagctggtgcgcggcatcaagccgagccacgtggactgc
tactacgtgcgccagcccgaggcgctcggactcggccacgcggtgctgtgcgccgagaag
ctggtgcacggcgagccgttcgcggtgatcctcgccgatgatctgctgcacggcgagcag
cccgtgctcaagcagctggtggacgtgttcaaccactatcacagctcggtgatcggcgtc
gaaacgatcgcgcgcgagcacagccgctcgtatggcgtggtcgaggggcgcgagtgggag
gaggacgtgatcaagctgtcgggcatcgtcgagaagccggcgccggaacacgcgccgtcc
aatctcggcgtggtcgggcgctatgtgctgatgccgagcgtcttcgatcacctgcggcgg
attcgccccggcgccggcggcgaactgcagctgaccgacgctgtgcagtcgctgctgacc
gaggagcaggtgctcgcctaccgctattacgggacgcgcttcgactgcggcagcaagctc
ggctacctgaaggcgaccgtcgagctcgcgctcgagcatcccgaggtaggccgcgaattc
gaggcctatctgcgcacctgcctgccggcgctggccgccgtcgcctga

DBGET integrated database retrieval system