KEGG   Burkholderia glumae: bglu_2g09520Help
Entry
bglu_2g09520      CDS       T00905                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bgl  Burkholderia glumae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bgl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1171997..1172803
Genome map
AA seq 268 aa AA seqDB search
MTALRDSLERIAIDAGAAILEVYRAGPDVAYKNDHSPVTDADQRAEAIILSGLAAAFPGV
PVVAEEAVAAGRVSEIGGGRFFLVDPLDGTREFIARRDDFTVNIALIEQGVPVAGIVLAP
ALRCAYVAVEGRAEKLVLGADLRVEARRPIRTRPRGASLTAVVSRSHHSRETEAFLADHG
VTDQASAGSSLKFCLLAEGRADVYPRFGRTMEWDTAAGHAVLSAAGGTVVRADGARLDYG
KTRQQGDSDFANPHFIAWADGASVTPRR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccttcgcgattcgctggaacgcattgccatcgacgccggcgcggcgatcctc
gaggtgtaccgcgccggccccgacgtggcttacaagaacgatcattcgcccgtgaccgac
gccgaccagcgtgccgaggcgatcatcctgtccgggctggccgccgcgtttcccggcgtc
ccggtggtggccgaggaagcggtcgccgccgggcgcgtgtccgagatcggcggcggccgg
ttcttcctcgtcgatccgctggacggaacccgggagttcatcgcccggcgcgacgatttc
accgtcaatatcgcgctgatcgagcagggcgtgccggtggccggcatcgtgctcgcgccg
gcgctgcgctgcgcctacgtggcggtcgagggccgcgccgagaagctcgtgctcggcgcg
gatctgagggtcgaggcgcgccggccgatccgcacgcgcccgcgcggggcgagcctgacg
gccgtggtcagccgctcccaccacagccgcgaaaccgaagcgtttctcgccgatcatggc
gtgaccgaccaggcgagcgccggctcgtcgctgaagttctgcctgcttgcggaaggccgc
gcggatgtctacccgcgcttcggccgcaccatggagtgggacacggcggccggccacgcg
gtgctgagcgcggccggcggaacggtggtgcgcgcggacggcgcccggctcgactacggc
aagacccgccagcagggcgacagcgatttcgccaatccgcacttcatcgcctgggcggat
ggcgcgtcggtgacgccgcgccgataa

DBGET integrated database retrieval system