KEGG   Burkholderia glumae: bglu_2g09520Help
Entry
bglu_2g09520      CDS       T00905                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bgl  Burkholderia glumae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    bglu_2g09520
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     bglu_2g09520
Transfer RNA biogenesis [BR:bgl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    bglu_2g09520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1171997..1172803
Genome map
AA seq 268 aa AA seqDB search
MTALRDSLERIAIDAGAAILEVYRAGPDVAYKNDHSPVTDADQRAEAIILSGLAAAFPGV
PVVAEEAVAAGRVSEIGGGRFFLVDPLDGTREFIARRDDFTVNIALIEQGVPVAGIVLAP
ALRCAYVAVEGRAEKLVLGADLRVEARRPIRTRPRGASLTAVVSRSHHSRETEAFLADHG
VTDQASAGSSLKFCLLAEGRADVYPRFGRTMEWDTAAGHAVLSAAGGTVVRADGARLDYG
KTRQQGDSDFANPHFIAWADGASVTPRR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccttcgcgattcgctggaacgcattgccatcgacgccggcgcggcgatcctc
gaggtgtaccgcgccggccccgacgtggcttacaagaacgatcattcgcccgtgaccgac
gccgaccagcgtgccgaggcgatcatcctgtccgggctggccgccgcgtttcccggcgtc
ccggtggtggccgaggaagcggtcgccgccgggcgcgtgtccgagatcggcggcggccgg
ttcttcctcgtcgatccgctggacggaacccgggagttcatcgcccggcgcgacgatttc
accgtcaatatcgcgctgatcgagcagggcgtgccggtggccggcatcgtgctcgcgccg
gcgctgcgctgcgcctacgtggcggtcgagggccgcgccgagaagctcgtgctcggcgcg
gatctgagggtcgaggcgcgccggccgatccgcacgcgcccgcgcggggcgagcctgacg
gccgtggtcagccgctcccaccacagccgcgaaaccgaagcgtttctcgccgatcatggc
gtgaccgaccaggcgagcgccggctcgtcgctgaagttctgcctgcttgcggaaggccgc
gcggatgtctacccgcgcttcggccgcaccatggagtgggacacggcggccggccacgcg
gtgctgagcgcggccggcggaacggtggtgcgcgcggacggcgcccggctcgactacggc
aagacccgccagcagggcgacagcgatttcgccaatccgcacttcatcgcctgggcggat
ggcgcgtcggtgacgccgcgccgataa

DBGET integrated database retrieval system