KEGG   Burkholderia glumae: bglu_2g11250Help
Entry
bglu_2g11250      CDS       T00905                                 

Definition
Esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bgl  Burkholderia glumae
Brite
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     bglu_2g11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1436716..1437567)
Genome map
AA seq 283 aa AA seqDB search
MSGRTGVLLIHGLGGTEYDLGSLHKAIRRAGGDAHIITLPGHGTRPEDLVGVRAEAWLDA
VTAQYRVLEAEYDTLHVAGMCMGALVALLLCHRVRHAKGRLALLAAPVYIDGWSTPWYRT
LRHLLYRVPGLTERMRVEEGEPFGIKNPVIRALVKKKFARQDRFHYPWVPLATIRQVDRM
RAWVRAAAPDTPCPTLILHAREDELTSLRSARFLEAAMPDARCIVLENSYHMICADNDRD
AVARHVLAFFGFDPAHAQSPAMARRLARGGGSDEAAHALGDAP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcgcaccggcgtcctgctgatccacgggctgggcggcaccgagtacgatctc
ggctcgctgcacaaggcaatccgtcgggccggcggcgacgcgcacatcatcacgctgccg
ggccacggcacgcggcccgaggatctggtcggggtccgtgccgaggcctggctcgacgcc
gtcaccgcgcagtatcgcgtgctcgaggccgagtacgacacgctgcacgtggcgggcatg
tgcatgggcgcgctggtcgcgctgctgctgtgccaccgcgtgcgtcacgcgaaggggcgc
ctcgcgctgctggccgcgccggtctacatcgacggctggtccacgccctggtatcgcacg
ctgcgccacctgctgtatcgcgtgccgggcctgaccgagcgcatgcgcgtggaggagggc
gagccgttcggcatcaagaacccggtgatccgcgcgctcgtgaagaagaagttcgcacgc
caggaccgcttccattacccgtgggtgccgctcgcgacgatccgccaggtcgaccggatg
cgcgcctgggtgcgcgcggcggcgcccgacacgccgtgccccacgctgatcctgcacgcg
cgcgaggacgaactgacgagcctgcgctcggcgcgcttcctggaggcggcgatgcccgat
gcgcgctgcatcgtgctcgagaacagctatcacatgatttgcgccgataacgaccgcgac
gccgtcgcgcggcatgtgctcgcgttcttcggcttcgatccggcccacgcgcagagcccg
gcgatggcgcgccggctggcgcgcgggggcggctcggacgaggcggcgcatgcgctgggc
gacgcgccatga

DBGET integrated database retrieval system