KEGG   Burkholderia glumae: bglu_2g14160Help
Entry
bglu_2g14160      CDS       T00905                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bgl  Burkholderia glumae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1808946..1809884)
Genome map
AA seq 312 aa AA seqDB search
MASLETTRADTASRPARASAAAPIFGEGDGHAVLLLHGLSSSPLELRYLARYLHEEGFTV
CAPVLDGYSAGSSEQPMERWIEGAVREFDALAARYERVSVCGLSIGGALALRLIQERPQA
QALALLSLTLAYNGWAIPWYRFILDLAYYTPLRHRYRYREAEPFGLRNEALRAKIARAME
RDAFSEVGPAEISLPALHQANRLARLARQGLERIENDTLVIHAIDDETSSPRNPNYVIER
IGASFLRTIWLDDSYHMITSDNEREIVARETALFLRESEITHGAGSGANPPVVSKALARR
LRQLAAVARKSK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcctcgagacgacccgcgccgacaccgcgagccgcccggcccgcgcctcggcc
gccgcgccgatcttcggcgaaggcgatggccatgccgtgctgctgctgcacggcctgtcc
agttcgccgctcgaattgcgctacctggcgcgctacctgcacgaggaaggcttcacggtt
tgcgcgccggtgctcgacggctacagcgcgggctcgtccgagcagccgatggagcgctgg
atcgagggcgcggtgcgcgagttcgatgcgctcgcggcgcgctacgagcgcgtctcggtg
tgcgggctgtcgatcggcggggcgctcgcgctgcggctgatccaggagcgcccgcaggcg
caggcgctggcgctgctgtcgctgacgctggcctacaacggctgggcgatcccgtggtat
cgcttcatcctcgacctggcctactacacgccgctgcggcaccgctaccgctaccgcgag
gccgagccgttcggcctgcgcaacgaggcgctgcgcgccaagatcgcgcgagcgatggag
cgcgacgcgttcagcgaggtcggcccggcggaaatctcgctgccggcgctgcaccaggcc
aaccggcttgcgcgcctggcgcgccaggggctcgagcggatcgagaacgacacgctggtg
atccacgcgatcgacgacgagacctcgagcccgcgcaatccgaactacgtcatcgagcgg
atcggtgcaagctttctgcgcaccatctggctcgacgattcctatcacatgatcacctcg
gacaacgaacgggaaatcgttgcgcgcgagaccgcgctgttcctccgcgagagcgagatc
acgcacggcgccggcagcggagcgaatccgccggtggtgtcgaaggcgctcgcgcggcgg
ctgcgccagctcgcggcggtggcccgcaagagcaaatga

DBGET integrated database retrieval system