KEGG   Burkholderia glumae: bglu_2g14690Help
Entry
bglu_2g14690      CDS       T00905                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bgl  Burkholderia glumae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    bglu_2g14690
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bglu_2g14690
Enzymes [BR:bgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     bglu_2g14690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1867449..1868741
Genome map
AA seq 430 aa AA seqDB search
MTTPQQAFLRDAMRRLNLTREAFANRIGVSRRALDTWLLPDDSQESRSMPEIVERYVTEI
VARTSEEAKYTQSVDISSLASQIQFEGRPQLLSVDQFSRDSVEALFRVADVMQPIARRRK
ISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIHDTGRVM
AGYVDALVIRHPEQGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKIV
DGSHIAFVGDLKYGRTVHSLAKLLALYRGIRFTLVAPASLEMPRYIVEQISKNGHVIEET
TDLSRGLAGADVVYATRIQKERFTDESFEGYTPDFQINQALVDAVCQRDTLIMHPLPRDS
RPGANDLATDLNRDPRLAIFRQTDNGIPVRMAVFAVLLGVDHLVQHSMRDATWRSPVHLG
PEDAVFHGID
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccccagcaagccttcctgcgcgatgcgatgcgtcgcctcaacctgacccgc
gaagcgttcgcgaaccgcatcggcgtgagccgcagggcactcgatacctggctgctgccc
gacgactcccaggaatcgcgctcgatgcccgagatcgtcgaacgctatgtgacggaaatc
gtcgcgcgcacttcggaagaagcaaaatatacgcaaagcgtagatatctcatcgcttgcg
agtcagatccagttcgaggggcgcccgcagctgctgtccgtcgatcagttctcgcgcgac
tcggtcgaagcgctgttccgcgtggccgacgtgatgcagccgatcgcgcgccgccgcaag
atctcgcgcgtgctggagggcgccgtgctcggcaacctgttcttcgaggccagcacgcgc
acccgcgtgtcgttcggcgccgcgttctgccggctcggcggctcggtctgcgacaccacc
ggcttcacgttctcgtcgatggccaagggcgaatcgatccacgacaccggccgcgtgatg
gccggctatgtcgatgcgctcgtgatccgccatcccgaacagggctcggtggccgagttc
gcgcgcgcgaccaacctgccggtgatcaacggcggcgacggccccggcgagcacccgagc
caggcgctgctcgatctctacacgatccagcgcgagttctcgcggctcggcaagatcgtc
gacggctcgcacatcgcgttcgtcggcgacctgaaatacggccgcaccgtccactcgctg
gccaagctgctggcgctctatcgcggcatccgcttcacgctggtcgcgccggcctcgctg
gagatgccgcgctacatcgtcgagcagatctcgaagaacggccacgtgatcgaggaaacc
accgatctgtcacgcgggctggccggcgcggacgtggtctacgccacgcggatccagaag
gagcgcttcaccgacgaatcgttcgagggctacacgcccgacttccagatcaaccaggcg
ctcgtcgacgccgtgtgccagcgcgacacgctgatcatgcacccgctgccgcgcgacagc
cggcccggcgccaacgatctcgccaccgacctgaaccgcgacccgcggctggcgatcttc
cgccagaccgacaacggcattccggtgcgcatggcggtgttcgccgtgctgctcggcgtc
gatcatctggtgcagcactcgatgcgcgacgcgacctggcggtcgcccgtgcaccttggc
cccgaggacgcggtattccacgggatcgactga

DBGET integrated database retrieval system