KEGG   Burkholderia glumae BGR1: bglu_2g14850Help
Entry
bglu_2g14850      CDS       T00905                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00010  Glycolysis / Gluconeogenesis
bgl00071  Fatty acid degradation
bgl00350  Tyrosine metabolism
bgl00625  Chloroalkane and chloroalkene degradation
bgl00626  Naphthalene degradation
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_2g14850
  Lipid metabolism
   00071 Fatty acid degradation
    bglu_2g14850
  Amino acid metabolism
   00350 Tyrosine metabolism
    bglu_2g14850
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    bglu_2g14850
   00626 Naphthalene degradation
    bglu_2g14850
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     bglu_2g14850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Peripla_BP_6 Mersacidin
Motif
Other DBs
NCBI-ProteinID: ACR31842
UniProt: C5AIW2
Position
2:1887992..1889176
Genome map
AA seq 394 aa AA seqDB search
MQAFSFQTVAHIVLEAGIAKRLGQALRERHAGRRACVVTDAFLHRGGTLAPALASLGAAG
WEVLVIDEVVADPPDEVVRDAARRAREFGAELVIGLGGGSSMDVAKLVAVLGASAQPLEQ
MYGVNRVQGTRLPLVQIPTTAGTGSEVTPIAIVTTGKTTKSGVVAPQLYADAAYLDPELT
VGLPPAATAATGIDAMVHAIEAYTSKRLKNPLSDHLAGKALQLLSANLLPACRDGGDLAA
RSAMLLGAMLAGQAFANAPVAGVHALAYPIGGVFHVPHGLSNALVLPHVLRFNARVPAAA
QAYAELGQLIGLQPAGSFDEQAEAFIAHLVRLARDAGLPSNLQAVGIGVADLGGLAADAM
KQERLLINNPCEIDEPSALEIYRQAFEHTYDELA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgttttcgtttcagaccgtcgcgcacatcgtgctcgaggccggcatcgccaaa
cgtctcggccaggcgctgcgcgagcgccatgcgggccgccgcgcctgcgtcgtcaccgac
gcattcctccatcgcggcggcacgctggcgccggcgctcgcgagcctcggcgcggcgggc
tgggaagtgctggtgatcgacgaggtggtggccgatccgcccgacgaggtggtgcgcgac
gccgcccgccgcgcgcgcgagttcggcgccgaactcgtgatcgggctgggcggcggctcg
tcgatggacgtcgcgaagctggtggccgtgctcggcgcgagcgcgcagccgctcgagcag
atgtacggcgtgaaccgcgtgcagggcacccgcctgccgctggtgcagattcccaccacg
gccggcaccggctccgaggtcacgccgatcgcgatcgtgaccaccggcaagaccaccaag
agcggcgtggtggcgccgcagctctatgccgacgccgcctacctcgatcccgagctgacc
gtcgggctgccgcccgccgcgacggccgccaccggcatcgacgcgatggtccacgcgatc
gaggcctacaccagcaagcggctgaagaatccgctgtccgatcatctcgccggcaaggcg
ctccagctgctgagcgcgaacctgctgccggcctgccgcgacggcggcgatctcgcggcg
cgctcggccatgctgctcggcgcgatgctggccgggcaggcgttcgcgaacgcgccggtg
gccggcgtccacgcgctcgcctatccgatcggcggggtgttccatgtgccgcacgggctg
tcgaacgcgctggtgctgccgcacgtgctgcgcttcaatgcgcgcgtgcccgccgccgcg
caggcctatgccgaactgggccagctcatcgggctccagccggcaggctcgttcgacgag
caggccgaggccttcatcgcccatctggtgcggctcgcgcgcgacgccgggctgccgtcg
aacctgcaggccgtgggcatcggcgtggccgatctgggcggcctcgcggccgacgcgatg
aagcaggagcggctgctgatcaacaatccctgcgagatcgacgagccgagcgcgctcgag
atctaccggcaggccttcgagcatacctacgacgagctcgcgtaa

DBGET integrated database retrieval system