KEGG   Burkholderia glumae: bglu_2g15570Help
Entry
bglu_2g15570      CDS       T00905                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bgl  Burkholderia glumae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bglu_2g15570
Enzymes [BR:bgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     bglu_2g15570
Exosome [BR:bgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bglu_2g15570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1973412..1975610
Genome map
AA seq 732 aa AA seqDB search
MSDTLFAPDDIAALLDARHPDPFACLGRHRVGDRTVVRALFPGAHAVQVVARDGGRVLGE
LERVAPAGCFAGEIEADQPYRLAIDWITATQEIEDIYAFGPLLDDAALARFAGGDPFAVL
ECLGARTAEIDGVAGVIFAVWAPAAARVSVVGDFNAWDGRRNPMRLRRPWGVWELFIPAV
HAGARYKYELRAHDGRVLPLKADPCARATEAPPLTASVVADTAARERYAWQDGAWLARRA
GADAAQAPMSVYEVHPESWQRLGDPPRTPSWDELAERLIPYAAGMGFTHVELMPVAEYPF
GGSWGYQPLSPFAPSARFGPTEGFARFVDRAHAAGLGVIVDWVPAHFPTDQHGLAQFDGT
ALYEHADPREGFHPDWNTLVFNVGRHEVSAFLIASALAWVRDHHVDGLRVDAVASMLYRD
YSRASGEWIPNRYGGRENLESIAFLRALNDTLHGAGAPPGVLTIAEESTAWPGVTAPVAD
GGLGFDFKWNMGWMHDTLSYLREDPVHRRYHHDRLTFGLVYAFSERFVLPLSHDEVVHGK
GSLLAKVPGDPWQRFATLRAYYAFMWAHPGKKLLFMGGEFAQPGEFAHDAQPPWELLDAP
EHRGVQRLVRDLNRQLAAEPALHRLDCRPEGFGWLIGDDAANSVYAFVRRDGEGRLLVAV
CNFTPVPRDGYRLGLPAAGRWTELLNTDSAAYGGSNLGNDGAVFAQEAPLHGQRWSATLR
LPPLATLWLRPA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgctgttcgccccggacgacatcgccgccctgctcgacgcgcggcacccg
gacccgttcgcgtgcctgggccggcatcgcgtcggcgaccgcaccgtggtgcgcgcgctg
tttcccggcgcgcacgccgtgcaggtggtggcgcgcgacggcggccgcgtgctcggcgaa
ctcgaacgcgtggcgccggccggctgcttcgccggcgagatcgaggccgaccagccgtac
cggctcgcgatcgactggataacggccacccaggagatcgaggacatctatgcgttcggg
ccgctgctcgacgacgcggcgctcgcgcgcttcgccggcggcgacccgttcgccgtgctc
gagtgcctcggcgcgcgcaccgccgagatcgacggcgtggccggcgtgatcttcgcggtc
tgggcgccggccgccgcacgcgtgtcggtggtgggcgacttcaacgcctgggacgggcgc
cgcaacccgatgcggctgcgccggccgtggggcgtctgggaactgttcatcccggccgtg
catgcgggcgcgcgctacaagtacgagctgcgcgcgcacgacggccgcgtgctgccgctg
aaggccgacccctgcgcgcgcgccaccgaggcgccgccgctgaccgcctcggtggtggcc
gataccgccgcgcgcgagcgctacgcgtggcaggacggcgcctggctcgcgcgccgcgcc
ggggccgacgcggcgcaggcgccgatgtcggtctacgaggtgcatccggaatcatggcag
cggctcggcgacccgccgcgcacgccgagctgggacgagctggccgagcggctgatcccc
tacgcggcgggcatgggcttcacgcacgtcgagctgatgccggtggccgagtatccgttc
ggcggctcgtggggctaccagccgctctcgccgttcgcgccgtcggcgcgcttcgggccg
accgagggcttcgcgcgcttcgtcgatcgcgcgcacgcggccgggctcggcgtgatcgtc
gactgggtgccggcgcacttcccgaccgaccagcacggcctcgcgcagttcgacggcacc
gccctctacgagcatgccgatccgcgcgagggcttccatcccgactggaacacgctggtg
ttcaacgtcggccgccacgaggtcagcgcgttcctgatcgcctcggcgctggcctgggtg
cgcgaccatcacgtggacggcctgcgcgtggacgcggtggcctcgatgctctatcgcgac
tattcgcgcgcctcgggcgagtggattccgaaccgctacggcgggcgcgagaacctcgaa
tcgatcgcgttcctgcgcgcgctcaacgacacgctgcacggcgccggcgcgccgcccggg
gtgctgaccatcgccgaggaatcgaccgcctggcccggcgtgacggcgcccgtcgccgac
ggcggcctgggcttcgacttcaagtggaacatgggctggatgcacgacacgctgtcctat
ctgcgcgaggacccggtgcatcgccgctaccaccacgaccgcctgacgttcggcctggtc
tacgcgttctcggagcgcttcgtgctgccgctctcgcacgacgaggtggtgcacggcaag
ggctcgctgctcgcgaaggtgcccggcgatccgtggcagcgcttcgcgacgctgcgcgcc
tactatgcgttcatgtgggcgcatccgggcaagaagctgctgttcatgggcggcgagttc
gcccagcccggcgagttcgcgcacgacgcgcagccgccctgggagctgctcgacgcgccc
gagcatcgcggcgtgcagcgcctcgtgcgcgacctgaaccggcaactggccgccgagccc
gcgctgcaccggctcgactgccgccccgagggcttcggctggctgatcggcgacgacgcc
gccaacagcgtctatgcgttcgtgcgccgcgacggcgagggccgcctgctggtggccgtc
tgcaacttcacgccggtgccgcgcgacggctatcgcctcgggctgcccgcggccggccgc
tggaccgagctgctcaacaccgacagcgcggcctacggcggcagcaacctcggcaacgac
ggcgccgtgttcgcgcaggaggcgccgctgcacggccagcgctggtcggccacgctgcgc
ctgccgccgctcgccacgctctggctgcgcccggcctga

DBGET integrated database retrieval system