KEGG   Burkholderia glumae: bglu_2g15600Help
Entry
bglu_2g15600      CDS       T00905                                 

Definition
putative glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bgl  Burkholderia glumae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bglu_2g15600
Enzymes [BR:bgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     bglu_2g15600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1980068..1982467
Genome map
AA seq 799 aa AA seqDB search
MSTGQHTSLAALARAAGLEPEWTDAADQPRRVGDDALAVLLDALGLPAATAADRDASLAA
LTAPAAPPPLVTAAAGQAVPWPAAAGRPGGGYALTLEDGTRRTGRLLADPGGRGALLPAI
DAAGYHRVETDAASVTVAVAPARGWTIGDAAFVAGRQRPWGLAAQLYGLRRAGDFGIGDT
TALAALAGGAARLGADALAISPTHATFPAQPERDSPYSPSSRRWHNLAYLDPDDVAGPQA
TAAVLADTGLADTAARLAAAPLVDWPLAVRTKLRVLRALFERWRAHPSPDADGFARFVAD
GGAALHAHACFDALQAQMLADRREADWRRWPEALRGGPEAPGVRAFATAHADDVAFFAFA
QWLAARGLERAHRAARGAGMSIGTVADLAVGCAPDGSDAWAAPGSLLGAASIGAPPDLFN
ADGQAWGVTTWTPAALRASGFAPFIALLRAALTHAGGVRIDHILGFARLWIVRDGTSARD
GAYLRYPLDDLLRLVALESSRHRAIAIGEDLGTVPGGLRERLAACGIAGMRVLWFERDAD
GAFRRPEQWDRDAVAMPSTHDLPTLAGWWRGVDLAWRRHVTALDAGREAGGKAARAPGEA
AAPCAPARHEAFGASHSPADPPLTWPPAAPAPASPAAASTPGASAPLARDAETAAPAASP
SSTHPVPSDMNSSSPAHAPAAAPAPLPPDLAERAAERAALWRALAEARVVPPSASPTPPE
APPVAAALAFVARSASALALVPLEDLLALPAQQNLPGPPVGHPNWRRRMPRETAGLLDDA
AGATLAAIALARRTGPEAS
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggccagcacacctcgctcgccgcgctggcccgcgccgccgggctcgaaccc
gaatggaccgatgcggccgaccagccgcggcgggtcggcgacgacgcgctcgcggtgctg
ctcgacgcgctcggcctgcccgccgccacggccgccgatcgcgacgcgagcctggccgcg
ctgacggcgccggccgcaccgccgccgctcgtgacggccgcggcggggcaggcggtgccg
tggccggccgcggccgggcgacccggtggcggctatgcgctcacgctggaggacggcacc
cggcgcaccggccggctcctggccgatccgggcggccgcggcgcgctgctgcccgcgatc
gacgcggccggctaccaccgggtggaaaccgacgcagccagcgtgacggtggcggtggcg
cccgcgcgcggctggaccatcggcgacgcggccttcgtcgccgggcgccagcggccgtgg
gggctcgccgcgcagctctacgggctgcgccgcgccggcgacttcggcatcggcgacacc
accgcgctcgcggccctggccggcggcgccgcgcggctcggcgccgacgcgctggcgatc
agcccgacccatgccacgttcccggcccagcccgagcgcgacagcccgtattcgccgtcc
tcgcgccgctggcacaacctcgcctacctcgatcccgacgacgtggctggcccgcaggcc
acggccgccgtgctcgccgacaccgggctggccgacaccgccgcccggctggccgccgcg
ccgctggtggactggccgctcgcggtccgcaccaagctgcgcgtgctgcgcgcgctgttc
gagcgctggcgggcgcatccgtcgcccgatgccgatgggttcgcgcgcttcgtcgccgac
ggcggcgccgcgctgcacgcccatgcctgcttcgacgcgctgcaagcccagatgctggcc
gaccggcgcgaggccgactggcggcgctggcccgaggcgctgcgcggcggccccgaggcg
cccggggtacgcgcgttcgccaccgcgcacgccgacgacgtggcgttcttcgcgttcgcg
cagtggctcgccgcgcgcggactcgagcgtgcccaccgggccgcgcgcggcgcgggcatg
tcgatcggcaccgtggccgatctcgccgtgggctgcgcgcccgacggcagcgacgcgtgg
gccgcgcccggctcgctgctgggcgcggcctcgatcggcgcgccgcccgatctgttcaac
gccgacgggcaggcctggggcgtcacgacctggaccccggccgcgctgcgcgcgagcggc
ttcgcgccgttcatcgcgctgctgcgcgcggccttgacccatgccggcggcgtgcgcatc
gatcacatcctcggcttcgcgcggctctggatcgtgcgcgacggcacctcggcgcgcgac
ggcgcctacctgcgctatccgctcgacgacctgctgcggctggtcgcgctcgaatcgtcg
cggcatcgcgcgatcgcgatcggcgaggatctcggcaccgtgcccggcgggctgcgcgag
cggctcgcggcgtgcggcatcgccgggatgcgcgtgctgtggttcgagcgcgacgccgac
ggcgcgtttcgccggcccgagcaatgggaccgcgacgcggtggcaatgccgtccacccac
gatctgccgacgctggcgggctggtggcgcggagtcgatctggcctggcggcggcacgtg
acggcgctcgacgccgggcgtgaagccggcggcaaggcggcgcgcgcaccgggagaggcc
gccgcgccgtgcgcacccgcgcggcacgaggcgttcggcgcgtcgcactcgcccgccgac
ccgcccctcacctggccgccggcggccccggccccggcctcgcccgccgccgccagcacg
cccggcgcgtccgcaccgctcgcgcgcgatgccgaaacggcggccccggccgcctccccg
tcttcaacccatccggtgcccagcgacatgaattcatcctcccctgcccacgcgcccgcc
gccgcgcctgccccgctgccgcccgacctggccgagcgcgccgccgagcgcgccgcgctg
tggcgcgcgctcgccgaggcgcgggtggtgccgccgtcggcctcgcccacgccgcccgag
gcaccgccggtggccgccgcgctcgcgttcgtcgcgcgcagcgcctcggcgctcgcgctg
gtgccgctcgaggatctgctcgcgctgcccgcccagcagaatctgccggggccgccggtc
ggccatccgaattggcgccgccgcatgccgcgcgagacggcgggcctgctcgacgacgcc
gccggcgcgacgctggccgccatcgcgctggcgcggcgcaccggcccggaggcgtcatga

DBGET integrated database retrieval system