KEGG   Burkholderia glumae: bglu_2g17440Help
Entry
bglu_2g17440      CDS       T00905                                 

Definition
Pirin-like protein
Orthology
K06911  
 
Organism
bgl  Burkholderia glumae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2189333..2190058)
Genome map
AA seq 241 aa AA seqDB search
MIEVRNASDRGRAEHGWLSSRHTFSFANYYDPQQVGFSDLLVINDDRVAPGRGFGTHPHR
DMEILSYVLEGALEHKDSMGTGSVIVPGDVQLMSAGTGVAHSEFNHSRDADVHFLQIWIG
PAQKGAQPRYQQASVDAARKRGRLQLVVSPDAADGSLAIRQDTRIYAGLFDGAETASLAL
PDGRFGYVHVARGSVSVNGVALAEGDGARIRGERELTFSAGRDAEVLVFDLRPLEVTADW
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagtcagaaacgccagcgatcgcggccgcgccgagcacggctggctcagctcc
cgccacaccttctcgttcgccaactactacgacccgcagcaggtcggcttctcggacctg
ctggtgatcaacgacgatcgcgtcgcgccgggccgcggcttcggcacccatccgcaccgc
gacatggaaatcctctcctacgtgctggaaggcgcgctcgaacacaaggattcgatgggt
accggctcggtgatcgtgccgggcgacgtgcaactgatgagcgccggcacgggcgtcgcg
cacagcgagttcaaccactcgcgcgatgccgacgtccacttcctgcagatctggatcgga
ccggcgcagaagggcgcgcagccgcgctatcagcaggccagcgtcgacgcggcgcgcaag
cgcggccggctgcaactggtggtgtcgcccgatgccgccgacggttcgctcgcgatccgc
caggacacgcggatctatgccgggctgttcgacggcgccgaaacggccagcctcgcgctg
ccggacggccgcttcggctacgttcacgtggcccgcggcagcgtgtcggtgaacggcgtc
gcgctcgctgagggcgacggcgcgcggattcgcggcgagcgggagctgacgttctcggcc
ggtcgcgatgccgaggtgctggtgttcgacctgcgcccgctcgaggtgacggccgactgg
gcctga

DBGET integrated database retrieval system