KEGG   Burkholderia glumae: bglu_2g21310Help
Entry
bglu_2g21310      CDS       T00905                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bgl  Burkholderia glumae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bglu_2g21310
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     bglu_2g21310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2642389..2643624
Genome map
AA seq 411 aa AA seqDB search
MRVLFQRGCGRPRPARRPLAALTTAVAGLGACLGAAGAGHVEAAPPAAAHPQPAAARCGD
WSAYRAFIARNVQPDGRVFDASTPAQQSTSEGQSYGLFFALVANDRDNFERILGWIRENL
AGGHFSARDVRLPAWLWGRKGGAWGVLDPNSASDSDLWIAYDLLEAGRLWHVPDYTALGT
ALAAQVVRREVVDLAGLGPMLLPGPQGFVNGDVTRLNPSYLPLPVLRGLATQLGGDPWNA
LASNGLKLVAGASPHGFAPDWAAWRAGQVVVDPKTGDLGSYDAIRVYLWAGLANPADPLA
KPWLDAVRGMAARVAQTGVPPEKVAVATGVGSGEGPLSYWGALAPYFAALGDTRGLALAR
SRLTALDGEVPGHEPVYYDRVLGLFGAGAVAGRYHFDASGRLVPAWSKACR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcctgttccagcgcggctgcggccgcccacgtcctgcgcggcgcccgctcgcc
gcactgaccaccgccgtggccggcctcggcgcctgcctcggcgcggccggcgccggccat
gtcgaggccgcgccgccggccgcggcccacccgcagccggccgccgcgcgctgcggcgac
tggagcgcctaccgcgccttcatcgcgcgcaacgtgcagcccgacggccgcgtgttcgac
gcgtccaccccggctcagcagtcgacctcggaaggccagtcgtatggcctgttcttcgcg
ctggtggccaacgatcgcgacaacttcgagcgcatcctcggctggatccgcgagaatctg
gccggcggccatttcagcgcgcgcgacgtgcgcctgcccgcctggctgtggggccgcaag
ggcggcgcgtggggcgtgctcgatccgaactcggcatccgactcggacctctggatcgcc
tacgacctgctcgaggccgggcgcctctggcacgtgcccgactacaccgcgctcggcacc
gcgctggccgcgcaggtcgtgcgccgcgaggtggtcgatctcgccgggctcggcccgatg
ctgctgcccggcccgcagggtttcgtcaacggcgacgtcacgcgcctgaatccgagctac
ctgccgctgccggtgctgcgcgggctcgccacccagctcggcggcgacccgtggaacgcg
ctcgcgagcaacggcctgaagctggtggccggcgcctcgccgcacggcttcgcccccgac
tgggcggcctggcgcgcgggccaggtggtggtcgatccgaagaccggcgacctcggcagc
tacgacgcgatccgcgtctatctgtgggccggcctcgcgaatccggccgatccgctcgcc
aagccctggctcgacgccgtgcgcgggatggccgcgcgcgtggcgcagaccggcgtgccg
cccgagaaggtcgcggtggcgaccggcgtcggcagcggcgaaggcccgctcagctactgg
ggcgcgctcgcgccgtacttcgccgcgctcggcgacacgcgcggcctcgcgctggcacgc
tcgcgcctgaccgcgctcgacggcgaggtgccgggccacgagccggtctactacgaccgc
gtgctgggcctgttcggcgcgggcgccgtggccggccgctaccacttcgacgcgagcggc
cggctggtgccggcctggagcaaggcatgccgatga

DBGET integrated database retrieval system