KEGG   Burkholderia glumae: bglu_2g22010Help
Entry
bglu_2g22010      CDS       T00905                                 

Definition
GNAT family acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bgl  Burkholderia glumae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_2g22010
   00620 Pyruvate metabolism
    bglu_2g22010
   00640 Propanoate metabolism
    bglu_2g22010
Enzymes [BR:bgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     bglu_2g22010
Lipid biosynthesis proteins [BR:bgl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   bglu_2g22010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2731182..2733572)
Genome map
AA seq 796 aa AA seqDB search
MTVRNLDALFQPKSVAVVGASRRAGSLGAIVWARVLDGGFAGPIWPVNPKYDELNGHPVF
ARVARLPQPPSVALVCTPPASWPGIVRQLGELGARCAILVGEARTAGERASVERALAAAK
PYLLRIVGPGSLGVVTPQLNAHFGAPACCVSAGGVAWVSQSNALTNAALGWAKARGLGFS
HAVALGDEADVDAGDVLDYLASDPDTRAILLELDSIRSARKFMSAARAAARNKPVLALHT
GRTDAGDALYTAAFQQAGMVRVDALDDLLDEIETLGVGRVTASDAVTVVTSDAGVARLAV
DALAAVGDMRLAPWPSAATAALATVLPLPPGIEAGNPLLLGDNVRPEDFGAVVRALGKLG
GTGTLFVVHATSHNAPVEAVARELIEAKRASSHGVVACFFGGVDALTRDALHAQGIPVHT
TPQRLARAYARLVEYRHGRELLMQTPEGLPPEPPAAVARARDEAREAAARGPTKLDGAGA
AGWLAHFGLQPFTPGEPGGAESADTGSGVIVEMTVDMFDDPNFGPVFRYAVPAADGISAP
LVVYGLPPFNTVLARAVVRRSPYARRAAPEPLLDVLTALSLAVCEVRELVSLSLVLRVLP
RRVVFRDARLRFAAGRSRLAIMPYPRHLEQRVDWHGTTMTVRPIRPEDEAAHTALLDAMT
PDDLRMRFFGAIRSFDHSQVARMTQIDYDREMALIATVDDQDGKRQTLGVVRAVADPDNE
TAEFAIAIRADQKGKGLGRLLMARIIDYARSRGTQWLVGEALRENGAMIGLARASGFTVA
STAEPGVVGFRLKLQA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtccgtaatctcgatgcgttgtttcagccgaaatccgtggccgtggtgggcgcg
tcccggcgcgccggcagcctcggcgcgatcgtgtgggctcgcgtgctggacggcggattt
gccgggccgatctggcccgtcaatcccaagtacgacgaactgaacggacatccggtgttc
gcgcgcgtggcgcggctgccgcagccaccgtcggtggcgctcgtctgcaccccgcccgcc
agctggcccggcatcgtgcgccagctcggcgagctgggcgcgcgctgcgcgatcctggtc
ggcgaggcgcgcacggccggcgagcgcgcctcggtcgagcgcgcgctcgccgcagcgaag
ccgtatctgctgcgcatcgtcgggcccggcagcctcggcgtggtgacgccgcagctgaat
gcgcacttcggcgcgccggcctgctgcgtgagcgcgggcggcgtcgcctgggtctcgcag
tcgaacgcgctgacgaatgccgcgctcggctgggcaaaggcacgcgggctcggtttctcg
catgcggtcgcgctcggcgacgaggccgacgtcgatgcgggcgacgtgctcgactacctc
gcgagcgatcccgatacgcgcgcgatcctgctcgaactcgacagcatcaggtcggcgcgc
aagttcatgtcggccgcgcgcgcggcggcgcgcaacaagccggtgctggcgctgcacacg
ggccgcaccgatgccggcgacgcgttgtatacggccgcgttccagcaggcgggcatggtg
cgcgtcgatgcgctcgacgatctgctcgacgagatcgaaacgctcggcgtcgggcgcgtc
acggcgagcgacgcggtcaccgtcgtcaccagcgatgccggcgtcgcgcggctcgccgtc
gatgcgctggccgccgtcggcgacatgcggctcgcaccgtggccgtcggccgccacggcc
gcgttggccaccgtgctgccgctgccgcccggcatcgaggccggcaatccgctgctgctc
ggcgacaacgtgcggccggaagatttcggcgccgtcgtgcgcgcgctcggcaagctgggc
ggcaccggcacgctgttcgttgtccacgcaacttcccacaatgcgccggtcgaggcggtg
gcgcgcgaactgatcgaggcgaagcgcgcctcgtcgcacggcgtcgtggcctgctttttc
ggcggcgtcgacgcgctcacgcgcgatgcgctgcatgcgcagggcattcccgtgcacacc
acgccgcagcggctcgcacgcgcctacgcgcggctcgtcgagtaccggcatggccgcgag
ctgctgatgcagacgccggaaggcctgccgcccgagccgcccgccgcggtggcgcgtgcg
cgggacgaggcgcgcgaggccgccgcgcgcggcccgaccaagctcgacggcgcgggcgcg
gcgggctggctcgcgcatttcggattgcagccgttcacgcccggcgagccgggcggtgcc
gagtcggccgacacgggcagcggcgtgatcgtcgaaatgacggtcgacatgttcgacgat
ccgaacttcggcccggtgttccgctacgcggtgccggccgcggacggcatctcggcgccg
ctcgtcgtgtacgggctgccgccgttcaataccgtgctggcccgcgcggtcgtgaggcgt
tcgccctatgcacgccgcgcggcgcccgagccgctgctcgacgtgctgacggcgctgtcg
ctggcggtatgcgaggtgcgggagctcgtgtcgctgtcgttggtgctgcgcgtgctgccg
cgccgcgtcgtatttcgcgatgcgcgcctgcgcttcgcggcgggccgcagccggctcgcg
atcatgccttatccgcggcacctcgaacagcgcgtcgattggcacggcaccacgatgacg
gtgcggccgatccggcccgaggacgaggccgcgcatacggcgctgctcgacgcgatgacg
cccgatgatctgcgcatgcgcttcttcggcgcgatccgcagcttcgatcattcccaggtc
gcgcggatgacgcagatcgactacgaccgggagatggccctgatcgccaccgtcgatgat
caggacggcaagcggcagacgctcggcgtcgtgcgggccgtggccgaccccgacaacgag
acggccgagttcgcgatcgcgatccgcgcggaccagaagggcaagggactcgggcggctg
ctgatggcgcgcatcatcgactacgcgcgctcgcgcggcacgcagtggctcgtcggcgag
gcgctgcgcgagaacggcgccatgatcggcctcgcgcgcgcctcggggttcaccgtcgcg
tcgaccgcggagcccggtgtcgtcgggttccgcttgaagctgcaagcgtga

DBGET integrated database retrieval system