KEGG   Burkholderia glumae BGR1: bglu_2g22010Help
Entry
bglu_2g22010      CDS       T00905                                 

Definition
(GenBank) Acetyltransferase, GNAT family
Organism
bgl  Burkholderia glumae BGR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(2731182..2733572)
Genome map
AA seq 796 aa AA seqDB search
MTVRNLDALFQPKSVAVVGASRRAGSLGAIVWARVLDGGFAGPIWPVNPKYDELNGHPVF
ARVARLPQPPSVALVCTPPASWPGIVRQLGELGARCAILVGEARTAGERASVERALAAAK
PYLLRIVGPGSLGVVTPQLNAHFGAPACCVSAGGVAWVSQSNALTNAALGWAKARGLGFS
HAVALGDEADVDAGDVLDYLASDPDTRAILLELDSIRSARKFMSAARAAARNKPVLALHT
GRTDAGDALYTAAFQQAGMVRVDALDDLLDEIETLGVGRVTASDAVTVVTSDAGVARLAV
DALAAVGDMRLAPWPSAATAALATVLPLPPGIEAGNPLLLGDNVRPEDFGAVVRALGKLG
GTGTLFVVHATSHNAPVEAVARELIEAKRASSHGVVACFFGGVDALTRDALHAQGIPVHT
TPQRLARAYARLVEYRHGRELLMQTPEGLPPEPPAAVARARDEAREAAARGPTKLDGAGA
AGWLAHFGLQPFTPGEPGGAESADTGSGVIVEMTVDMFDDPNFGPVFRYAVPAADGISAP
LVVYGLPPFNTVLARAVVRRSPYARRAAPEPLLDVLTALSLAVCEVRELVSLSLVLRVLP
RRVVFRDARLRFAAGRSRLAIMPYPRHLEQRVDWHGTTMTVRPIRPEDEAAHTALLDAMT
PDDLRMRFFGAIRSFDHSQVARMTQIDYDREMALIATVDDQDGKRQTLGVVRAVADPDNE
TAEFAIAIRADQKGKGLGRLLMARIIDYARSRGTQWLVGEALRENGAMIGLARASGFTVA
STAEPGVVGFRLKLQA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtccgtaatctcgatgcgttgtttcagccgaaatccgtggccgtggtgggcgcg
tcccggcgcgccggcagcctcggcgcgatcgtgtgggctcgcgtgctggacggcggattt
gccgggccgatctggcccgtcaatcccaagtacgacgaactgaacggacatccggtgttc
gcgcgcgtggcgcggctgccgcagccaccgtcggtggcgctcgtctgcaccccgcccgcc
agctggcccggcatcgtgcgccagctcggcgagctgggcgcgcgctgcgcgatcctggtc
ggcgaggcgcgcacggccggcgagcgcgcctcggtcgagcgcgcgctcgccgcagcgaag
ccgtatctgctgcgcatcgtcgggcccggcagcctcggcgtggtgacgccgcagctgaat
gcgcacttcggcgcgccggcctgctgcgtgagcgcgggcggcgtcgcctgggtctcgcag
tcgaacgcgctgacgaatgccgcgctcggctgggcaaaggcacgcgggctcggtttctcg
catgcggtcgcgctcggcgacgaggccgacgtcgatgcgggcgacgtgctcgactacctc
gcgagcgatcccgatacgcgcgcgatcctgctcgaactcgacagcatcaggtcggcgcgc
aagttcatgtcggccgcgcgcgcggcggcgcgcaacaagccggtgctggcgctgcacacg
ggccgcaccgatgccggcgacgcgttgtatacggccgcgttccagcaggcgggcatggtg
cgcgtcgatgcgctcgacgatctgctcgacgagatcgaaacgctcggcgtcgggcgcgtc
acggcgagcgacgcggtcaccgtcgtcaccagcgatgccggcgtcgcgcggctcgccgtc
gatgcgctggccgccgtcggcgacatgcggctcgcaccgtggccgtcggccgccacggcc
gcgttggccaccgtgctgccgctgccgcccggcatcgaggccggcaatccgctgctgctc
ggcgacaacgtgcggccggaagatttcggcgccgtcgtgcgcgcgctcggcaagctgggc
ggcaccggcacgctgttcgttgtccacgcaacttcccacaatgcgccggtcgaggcggtg
gcgcgcgaactgatcgaggcgaagcgcgcctcgtcgcacggcgtcgtggcctgctttttc
ggcggcgtcgacgcgctcacgcgcgatgcgctgcatgcgcagggcattcccgtgcacacc
acgccgcagcggctcgcacgcgcctacgcgcggctcgtcgagtaccggcatggccgcgag
ctgctgatgcagacgccggaaggcctgccgcccgagccgcccgccgcggtggcgcgtgcg
cgggacgaggcgcgcgaggccgccgcgcgcggcccgaccaagctcgacggcgcgggcgcg
gcgggctggctcgcgcatttcggattgcagccgttcacgcccggcgagccgggcggtgcc
gagtcggccgacacgggcagcggcgtgatcgtcgaaatgacggtcgacatgttcgacgat
ccgaacttcggcccggtgttccgctacgcggtgccggccgcggacggcatctcggcgccg
ctcgtcgtgtacgggctgccgccgttcaataccgtgctggcccgcgcggtcgtgaggcgt
tcgccctatgcacgccgcgcggcgcccgagccgctgctcgacgtgctgacggcgctgtcg
ctggcggtatgcgaggtgcgggagctcgtgtcgctgtcgttggtgctgcgcgtgctgccg
cgccgcgtcgtatttcgcgatgcgcgcctgcgcttcgcggcgggccgcagccggctcgcg
atcatgccttatccgcggcacctcgaacagcgcgtcgattggcacggcaccacgatgacg
gtgcggccgatccggcccgaggacgaggccgcgcatacggcgctgctcgacgcgatgacg
cccgatgatctgcgcatgcgcttcttcggcgcgatccgcagcttcgatcattcccaggtc
gcgcggatgacgcagatcgactacgaccgggagatggccctgatcgccaccgtcgatgat
caggacggcaagcggcagacgctcggcgtcgtgcgggccgtggccgaccccgacaacgag
acggccgagttcgcgatcgcgatccgcgcggaccagaagggcaagggactcgggcggctg
ctgatggcgcgcatcatcgactacgcgcgctcgcgcggcacgcagtggctcgtcggcgag
gcgctgcgcgagaacggcgccatgatcggcctcgcgcgcgcctcggggttcaccgtcgcg
tcgaccgcggagcccggtgtcgtcgggttccgcttgaagctgcaagcgtga

DBGET integrated database retrieval system