KEGG   Burkholderia glumae: bglu_2p0550Help
Entry
bglu_2p0550       CDS       T00905                                 

Definition
D-amino acid oxidase Aao_1
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
bgl  Burkholderia glumae
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bgl00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bgl00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:bgl00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:bgl00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
bglu_2p:58154..59320
Genome map
AA seq 388 aa AA seqDB search
MREVGEKGRALVIGAGVAGQTTALCLHERGIHVTVVGEKFAPNITSVVAGALWEWPPAVC
GYHHDEISLERSKQWCMASFRKFEALAADPATGVYIRPVNFYFRNRIEEHALHLKKMNEI
RQHVPGFRRDPALIRENGVNPGIGLVDAYCHLAPMVDTDVYMAWLMDQMIANDIPVIQQR
IEGELQMNEARLKADFGVDAIVNCAGLGAAELSGEPMYPLRGAVIRLVNDGSRMPRLDQA
HCVSHDHVTGVDEIVFIVPRGEDRIVLGAIAEADEWGTDIGFDNHEPIRRMYRRGIEFMP
ALANAEIDPGEPVRVGLRPFSHGNVRLEAVSGTHILHNYAHGGAGVTLSWGCALEAAERV
ENMLSAAPDGIEQDGRPGAHANDVRVGA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagttggggagaaggggcgtgcgctagtcataggcgccggcgtggccggccag
acgacggcgctgtgcctgcacgagcgcggcatccatgtgacggtagtcggcgagaaattc
gcaccgaacattacgtcggtggtggccggggccttgtgggaatggccacccgccgtttgc
ggttatcaccacgacgagatctcgctggagcgctcgaagcagtggtgcatggcctcgttc
cgcaagttcgaggcactcgcggccgatccggcgacgggcgtctatatccgtccggtcaat
ttctactttcgcaaccgcatcgaggaacacgcactccatctcaagaagatgaacgagatc
cgccagcacgtgccgggtttccggcgcgacccggccctgatccgcgagaacggcgtgaat
ccgggcatcggactcgtcgacgcatattgtcatctcgcgccaatggtcgatacagacgtc
tacatggcctggctgatggatcagatgatcgcaaacgacatcccggtcatccagcagcgg
atcgaaggtgagctgcagatgaacgaggcgcgcctgaaggcggatttcggcgtcgatgcg
atcgtcaactgtgcgggactcggcgcggccgagttgagcggcgagccgatgtatccgttg
cgcggtgccgtgatccgtctcgtgaacgacggcagcagaatgccgcgcctcgatcaggcg
cactgcgtgtcacacgatcatgtaacgggtgtcgacgagatcgtattcatcgtgccgcgt
ggcgaggaccgaatcgtgcttggtgcgatcgcggaagccgacgaatggggaacggacatc
ggattcgacaatcacgaaccgatccggcgaatgtatcggcggggcatcgaattcatgccc
gcgctcgcgaacgccgagatcgatcctggcgagccggtgcgggtcgggctgcggccgttc
agccatggcaacgtgcgtctcgaagcggtatcgggcacccacatcctgcacaactacgcg
cacggtggggccggtgtgacgttgtcgtggggttgcgcgctcgaggctgcggagcgggtc
gagaacatgctgtcagccgccccggacggcatcgagcaggatggccgtccaggcgcccac
gccaacgacgtgcgggtcggggcttga

DBGET integrated database retrieval system