KEGG   Burkholderia glumae: bglu_3p0310Help
Entry
bglu_3p0310       CDS       T00905                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bgl  Burkholderia glumae
Brite
Enzymes [BR:bgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     bglu_3p0310
Secretion system [BR:bgl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bglu_3p0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
bglu_3p:complement(35339..36160)
Genome map
AA seq 273 aa AA seqDB search
MSGSDTVRAAGQRPPRAVPLVPAVNPADPNLEPGLAALQASLHARYPATRFRQITPTPAT
GIYEVVMGDKIAYTDQTGRYFLFGHLFDMVTQQDLTVPLEQALQKVRFPADRLQDAFVEV
HGDGHRKVAIFDDPDCPYCLSLEAELAALKDVTIYRFLYPLESIHPRARAHAIGIWCADD
RLGAWHAWLPVALSRWMRDHGSSVIGAAGQRKVPPSPARVEPKLASCDNPIDRNEALAAS
LGINGTPSLVSVDGRVMPGAATAEAIDQWLGAN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcggacaccgttcgggccgccggccagcgccccccgcgcgcggttcccctg
gtgccagcggtcaacccggcggacccgaatctcgaaccgggcctggccgcgctccaggca
tcgttgcacgctcggtatccggccacgcggttccggcaaatcaccccgacgcccgccacc
ggcatctacgaggtcgtgatgggcgacaagatcgcctacacggaccagaccggccgctac
ttcctcttcggccatctcttcgacatggtcacgcagcaggacctgaccgtgccgctcgag
caggcgctgcagaaggtgcgcttcccggccgaccgcctccaggatgcgttcgtggaggtg
catggcgacggccaccgcaaggtcgcgatcttcgacgaccctgactgtccctattgcctc
tccctcgaagctgaactcgccgcgctcaaggacgtcacgatctaccggttcctgtacccg
ctcgagtcgatccacccacgagcccgcgcccatgcaatcggtatctggtgtgcggacgac
cgccttggcgcctggcatgcatggcttccggtcgcgctgtcccgctggatgcgagatcac
ggctccagcgtgatcggtgcggccggccagcgcaaggtgccgccctcgccggcgcgcgtc
gagccgaagctcgcgtcttgcgacaacccgatcgacaggaacgaagccctcgcggccagc
ctcggcatcaatggcacgccgtccctcgtaagcgtcgacggccgcgtgatgcccggtgcc
gcgactgccgaggcaatcgaccagtggctgggagcgaattga

DBGET integrated database retrieval system