KEGG   Burkholderia glumae: bglu_4p0360Help
Entry
bglu_4p0360       CDS       T00905                                 

Definition
Protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bgl  Burkholderia glumae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
bglu_4p:complement(39913..40734)
Genome map
AA seq 273 aa AA seqDB search
MSGSDTVRAAGQRPPRAVSLVPAVNPADPNLEPGLAALQASLHARYPATRFRQISPTPAT
GIYEVVMGDKVAYTDVTGRYFLFGHLFDMVTQQDLTVPLEQALQKVRFPADRLQDAFVEV
HGDGHRKVAIFDDPDCPYCLSLEAELAALKDVTIYRFLYPLESIHPRARAHAIGIWCADD
RLGAWHAWLPVALSRWMRDHGPSVIGAAGQRKAPPAPARVEPKLASCDNPIDRNEALAAS
LGINGTPSLVSVDGRVMPGAATAEAIDQWLGAN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcggacaccgttcgggccgccggccagcgccccccgcgcgcggtttccctg
gtgccagcggtcaacccggcggacccgaatctcgaaccgggcctggccgcgctccaggca
tctttgcacgctcggtatccggccacgcggttccggcaaatcagcccgacgcccgccacc
ggcatctacgaggtcgtgatgggcgacaaggtggcctacaccgacgtcaccggccgctac
tttctgttcggccatctcttcgacatggtcacgcagcaggacctgaccgtgccgctcgag
caggcgctgcagaaggtccgcttcccggctgaccgcctccaggatgcgttcgtggaggtg
catggcgacggccaccgcaaggtcgcgatcttcgacgaccctgactgtccctattgcctc
tccctcgaagctgaactcgccgcgctcaaggacgtcacgatctaccggttcctgtacccg
ctcgagtcgatccacccacgagcccgcgcccatgcaatcggtatctggtgtgccgacgat
cgccttggcgcctggcacgcatggcttccggtcgcgctgtcccgctggatgcgcgatcac
ggccccagcgtgatcggtgcggccggccagcgcaaggcaccgcccgcgccggcgcgcgtc
gagccaaagctcgcgtcttgcgacaacccgatcgacaggaacgaagccctcgcggccagc
ctcggcatcaatggcacgccgtccctcgtaagcgtcgacggccgcgtgatgcccggcgcc
gcaactgccgaggcaatcgaccagtggctgggagcgaattga

DBGET integrated database retrieval system