KEGG   Borrelia garinii NMJW1: BgCN_0164Help
Entry
BgCN_0164         CDS       T02299                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BgCN_0164
Enzymes [BR:bgn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BgCN_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(167718..169238)
Genome map
AA seq 506 aa AA seqDB search
MKYKKIRINLNLKRKSGILLNISSLPSKYGIGDLGKGAYKFIDFLFASSQSYWQMFAYSP
IDFTRSPPYSIFSAFAGNVYYIDLEALDKFIDSDLNLLKENETRYSDLKKLSFKDKFLKE
AALNFINRASVDEVRSFEKFKKKSSYWLLDFASFVAFKEYFLKDSRDAFNVLFDRGILKR
NEKDLFKLRNILSKEIKVQEVLQYFFFSQFQALKRYANDKGIELVMNVPFFIAYDSADVW
AHQKYFKLRFDASKDKVAGISPDYFLEQEQAWDSPAYSWNVLKKVKYEWWAKRIGILRKY
VDVIKIDHFRGFVSTWEVSVGEAYAFNGLWVKSPGRDFFNFILNEIKDLKIWVEDFENDL
EDVSRLRDFFNFPGMRIMKLAFDFDSDNQNLPHNYIKNCIVYTGIGDNDTIREFVNSLDD
LHKKYIFDYLNTNEDFVVWDMIRSAMGSVSDSVIIPMQDYINLGDEFRANIPKNTLNNWI
FRLLESDLDATLSKNISFITRLYGRD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaaaaataagaattaatttaaatttaaaaagaaaaagtggtattttgctt
aacataagttctttgccatctaaatatggtattggagatttgggtaaaggggcttataaa
tttatagactttttgtttgcatcttcgcaaagctattggcaaatgtttgcttattctcct
attgattttacaagatctcccccttattcaattttttcggcttttgctggcaatgtttat
tatattgatttagaggctcttgacaaatttatagattcagatttaaaccttttaaaggaa
aatgaaaccagatactctgatttaaaaaaattaagctttaaagataaatttcttaaagaa
gctgctttaaattttattaatagagcttcggttgatgaggttagaagctttgaaaaattt
aaaaaaaagtcttcttattggcttttagattttgcaagttttgttgcatttaaagaatat
tttttaaaagattcaagggatgcttttaatgttctttttgatagaggaattcttaaaaga
aatgaaaaagacttatttaaattgagaaatatcctctcaaaagagattaaagtgcaagaa
gtgctacagtatttctttttttcacagtttcaagctttaaagcgttatgcaaatgacaaa
ggaattgagctagttatgaacgtgcctttttttatagcgtatgattctgctgatgtttgg
gcgcatcaaaaatattttaagttaagatttgatgcaagcaaagataaggttgcaggaatt
tccccagattattttttagagcaagagcaagcttgggacagtccagcttatagctggaat
gttttaaagaaagttaagtatgaatggtgggcaaaaaggattggaattttaagaaagtat
gtagatgtaattaaaattgatcatttcagaggttttgtttctacttgggaagttagtgtt
ggtgaggcctatgcttttaatgggttgtgggtaaagtcaccaggacgagatttttttaat
tttattttaaatgaaattaaagatttaaaaatttgggttgaagattttgaaaatgatctt
gaagatgtttcaaggttaagagatttttttaattttccaggaatgagaataatgaagctt
gcctttgattttgattcggacaatcagaatcttcctcataattatattaaaaattgtata
gtttatacaggaattggcgataatgacacaatacgagaatttgttaattctttagatgat
ttgcataaaaagtatatttttgattatttaaatacaaatgaagattttgttgtttgggac
atgataagaagtgctatgggtagcgtttctgatagcgtaataataccgatgcaagattat
attaatttaggagatgaatttagggcaaatattccaaaaaacactttaaacaattggatt
tttagattattagaaagtgatttagatgctactttgagtaaaaatataagttttattaca
aggctttatggcagggattaa

DBGET integrated database retrieval system