KEGG   Borrelia garinii NMJW1: BgCN_0208Help
Entry
BgCN_0208         CDS       T02299                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BgCN_0208
   00052 Galactose metabolism
    BgCN_0208
   00500 Starch and sucrose metabolism
    BgCN_0208
   00520 Amino sugar and nucleotide sugar metabolism
    BgCN_0208
Enzymes [BR:bgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BgCN_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208474..209397
Genome map
AA seq 307 aa AA seqDB search
MNKNFKTIFKNIEYIKLNFCYNLISREKSMKGIILAAGYGTRFLPITKTIPKEMLPILNK
PVIDYIIQEFIDSGIKDILLISSRRKKVLEDYFDREIELENIFLKENKKNELEKIKNKKI
NISFIRQKEMLGTGNALLYAKPWINREPVIVAYPDDLHIGNPPLSLQLIKLYEKTGKNII
SIIENPENINRYGVIDLYEDKIHVKNIVEKPKIGSEPSNKASIGRFLYNYEFFEHLEEGF
KLHQKGEYYHIYALKKLMDQKKVLYKNIKGKRIDIGTLEGYLEAIINFAKKDKKLMEIIK
KGINEND
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaattttaaaacaatttttaaaaacattgaatatataaaattaaatttttgc
tataatcttatttcaagagagaaaagtatgaaaggcattattctagcagctgggtatgga
acaagatttttaccaataacaaaaacaattccaaaagaaatgttgccaattttaaacaag
ccggtcatagattatattatccaagaatttatcgattcaggaataaaagacattttatta
ataagctcaagacgaaaaaaagttcttgaagattattttgatagagaaattgaacttgaa
aatatttttttaaaagaaaataaaaaaaatgaattagaaaaaatcaaaaacaaaaaaatt
aacataagcttcataagacaaaaagaaatgctgggcacaggaaatgctctgctttatgca
aaaccctggataaatagagagcctgtaattgtagcttaccctgacgatcttcacattgga
aatccaccattaagcttacaattaatcaaactttatgaaaaaactggaaagaacataata
tctattattgaaaatccagaaaatataaacagatacggagtaatagatctatatgaagat
aaaatccatgtaaaaaacattgttgaaaaaccaaaaattggaagtgagcctagcaataaa
gcatctattggaagatttttgtataactatgagttttttgaacatttagaagaaggattt
aaactacatcaaaagggtgaatactatcacatttatgctttaaaaaaactcatggatcaa
aaaaaagtattatataaaaatattaaggggaaaagaattgatataggaactcttgagggc
tatttagaagcaataataaattttgcaaaaaaagataaaaaattaatggaaattataaaa
aaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system