KEGG   Borrelia garinii NMJW1: BgCN_0208Help
Entry
BgCN_0208         CDS       T02299                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bgn00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bgn00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bgn00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208474..209397
Genome map
AA seq 307 aa AA seqDB search
MNKNFKTIFKNIEYIKLNFCYNLISREKSMKGIILAAGYGTRFLPITKTIPKEMLPILNK
PVIDYIIQEFIDSGIKDILLISSRRKKVLEDYFDREIELENIFLKENKKNELEKIKNKKI
NISFIRQKEMLGTGNALLYAKPWINREPVIVAYPDDLHIGNPPLSLQLIKLYEKTGKNII
SIIENPENINRYGVIDLYEDKIHVKNIVEKPKIGSEPSNKASIGRFLYNYEFFEHLEEGF
KLHQKGEYYHIYALKKLMDQKKVLYKNIKGKRIDIGTLEGYLEAIINFAKKDKKLMEIIK
KGINEND
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaattttaaaacaatttttaaaaacattgaatatataaaattaaatttttgc
tataatcttatttcaagagagaaaagtatgaaaggcattattctagcagctgggtatgga
acaagatttttaccaataacaaaaacaattccaaaagaaatgttgccaattttaaacaag
ccggtcatagattatattatccaagaatttatcgattcaggaataaaagacattttatta
ataagctcaagacgaaaaaaagttcttgaagattattttgatagagaaattgaacttgaa
aatatttttttaaaagaaaataaaaaaaatgaattagaaaaaatcaaaaacaaaaaaatt
aacataagcttcataagacaaaaagaaatgctgggcacaggaaatgctctgctttatgca
aaaccctggataaatagagagcctgtaattgtagcttaccctgacgatcttcacattgga
aatccaccattaagcttacaattaatcaaactttatgaaaaaactggaaagaacataata
tctattattgaaaatccagaaaatataaacagatacggagtaatagatctatatgaagat
aaaatccatgtaaaaaacattgttgaaaaaccaaaaattggaagtgagcctagcaataaa
gcatctattggaagatttttgtataactatgagttttttgaacatttagaagaaggattt
aaactacatcaaaagggtgaatactatcacatttatgctttaaaaaaactcatggatcaa
aaaaaagtattatataaaaatattaaggggaaaagaattgatataggaactcttgagggc
tatttagaagcaataataaattttgcaaaaaaagataaaaaattaatggaaattataaaa
aaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system