KEGG   Borrelia garinii NMJW1: BgCN_0243Help
Entry
BgCN_0243         CDS       T02299                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BgCN_0243
Enzymes [BR:bgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BgCN_0243
Exosome [BR:bgn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BgCN_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245808..247313
Genome map
AA seq 501 aa AA seqDB search
MKYILSIDQGTTSSRAIVFDKHANIKGLAQKEFTQIYPQPSWVEHDPTEIWGSQLGVITE
ALANSRILPNEVDAIGITNQRETTVIWEKSTGKPIYNAIVWQDRRTAKICDQLTKEGKDK
IILEKTGLVLDSYFSGTKILWILDNVEGARQKAENGELCFGTIDTWLLWNLTQKKVHATD
YSNASRTLLLNIKTLEWDDELLKILNIPKAILPELKESSTIYGETDKSIFGAEIPIAGIA
GDQFAATFGQACLKKGMAKNTYGTGCFLTVNIGKEPIINHERLLTSIAWGRKKTVTYVLE
GSVFIGGAVIQWLRDGLEFFRKSSDAESLASSASDNGGVYFVPAFVGLGAPHWDSYARGT
IIGITRGSTKAHITRAALESIAFQSFDILNTMKKSIPNFEIKELRVDGGASQNNLLMQFQ
ADLLECKVVRPKITETTALGAAYLAGLASGYWQSAEEIISLWQVDKIFEPSMPKNQKEKL
LENWNRAIERSKSWIQNSNSL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattttatctattgatcaaggcactactagctcaagagcaatagtatttgat
aaacatgcaaacataaaagggcttgctcaaaaagaatttactcaaatttatccacaacca
agctgggtggagcatgatcctactgaaatatggggatcgcaacttggagttataacagaa
gctcttgcaaattcaagaattttaccaaatgaagttgatgctattggaataactaatcaa
agagaaactacagttatatgggaaaaaagcacaggaaaacctatttataatgcaatagta
tggcaagatagaagaactgcaaaaatttgtgaccaattaacaaaagagggaaaagataaa
attattttggaaaaaacaggcttggtactagattcttattttagtggtacaaaaatactg
tggatcttggataatgtagagggtgctagacaaaaagctgaaaatggtgaattgtgtttt
ggaacaatagatacatggctattatggaatctgactcaaaaaaaagtacatgcaactgac
tattctaatgcttcaagaacattattgttaaacattaaaacattagaatgggatgatgaa
cttttaaagatattaaatattccaaaagcaattttacccgaacttaaagaaagctctaca
atatatggcgaaacagacaaatcgatatttggagcagaaattcctattgcaggaattgcc
ggagatcaatttgcagcaacatttggacaagcctgccttaaaaaaggtatggctaaaaac
acatatggaactggttgctttttaacggttaatataggcaaagaaccaattattaaccat
gaaagacttttaacttcaatcgcgtggggaagaaaaaaaaccgtaacttatgttcttgaa
ggaagtgtttttattggtggagctgtaatccagtggctaagagacggtcttgaatttttc
agaaaaagctcagatgcagaatcattggcaagctctgcttcagataatggaggagtttat
tttgtaccagcatttgttggacttggtgcacctcattgggattcttatgcaagaggaaca
atcatcggaataacaaggggatcgacaaaagcgcacattacaagagctgctcttgagagc
atagcatttcaaagttttgatatactaaataccatgaaaaaatccattcccaactttgaa
attaaagaattaagagtagacggaggagcaagtcaaaacaatctattaatgcaatttcaa
gctgatcttttagaatgtaaagttgtaagaccaaaaataacagaaacaacagcacttgga
gctgcttatcttgcagggcttgcatcaggttattggcaaagcgccgaggaaatcataagt
ctttggcaagtagataaaatatttgaaccttcaatgccaaaaaatcaaaaagaaaagctt
cttgaaaattggaacagagcaattgaaagatcaaaatcctggatacagaattccaatagt
ctataa

DBGET integrated database retrieval system