KEGG   Borrelia garinii NMJW1: BgCN_0492Help
Entry
BgCN_0492         CDS       T02299                                 

Definition
D-inositol-3-phosphate glycosyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BgCN_0492
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BgCN_0492
Enzymes [BR:bgn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BgCN_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
490161..491444
Genome map
AA seq 427 aa AA seqDB search
MYSYIVEGGFKIGGQITASGNKNSALPCILAALLTDEDVILENIPNINDVKVVLDILSDI
GADIAREGNALKIKVSNIVKTEIDSSFTDLIRASILLLGPFVSRFGEIDMALPGGDVIGK
RRLDTHFYGLSKLGAKLIDKDGRIVLKAKKLVGAEMFLDEASVTATENIIMASVLAEGNT
VIMNAACEPHVQDLCNMLNSMGANILGIGSNVLEIKGVKKLRGTTFRIGADFMQVGSLIS
LAALTGGELEIKKADPQHFRLIRHIYSRLGINFEYDKENVYVRDKQELKVKLDFGGHIPK
IDDGPWPAFPTDLMSIIIVTATQVEGTVLVFEKMFESRMFFVDKLIKMGAQIVLCDPHRV
VVTGKSPLKGNVLSSPDVRAGMSLLIAAFVAEGRSEIQNVYQIERGYEDVANKLINLGAR
IKKVKNQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttatattgtagaaggtggttttaagataggtggtcaaattacagctagcggc
aataagaattctgctttaccttgtattttagcggctttacttaccgatgaagatgttatt
ttagaaaatattcctaatattaatgatgtaaaagttgttttagatattttaagtgatata
ggagcagatattgcaagagaggggaatgctttaaaaataaaagtttcaaatattgtgaaa
acagaaatagattcctcttttacggatttaattagggcctccatacttttattaggacct
tttgtctctagatttggggaaatagatatggcgcttccaggaggagatgtgattggaaaa
aggcggcttgacactcatttttatggcctttctaaactaggagctaagttaatcgacaaa
gatggaagaattgttttaaaggccaaaaagcttgttggagctgaaatgtttttagatgaa
gcttctgttacagctacagaaaatattattatggcttcagttcttgccgaaggaaatact
gttattatgaacgctgcttgtgagccacatgttcaagatttatgtaatatgttgaattca
atgggtgctaatattttagggattggttcaaatgttttagaaataaagggtgtaaaaaaa
ttaagaggaaccacatttagaataggtgccgacttcatgcaagttggctctttgattagt
cttgctgcattaacagggggcgaattggaaattaaaaaagcagatccccaacatttcaga
ttaattagacatatatattcaaggcttggtattaattttgaatatgacaaggaaaatgta
tacgtaagagataaacaagagttaaaagttaagctagattttggcggacacattccaaaa
attgatgatggtccatggcccgcctttccgacagaccttatgagtattattatagtcact
gcaactcaagtagaaggcacagttcttgtttttgaaaaaatgtttgaatccaggatgttt
tttgtagacaaattaataaaaatgggggctcaaattgtactttgtgatccacaccgtgta
gtagttactggcaaatctcctcttaaaggcaatgttttatcttctccagatgtgcgggca
ggaatgtctcttcttattgctgcttttgttgctgaaggtcgcagcgagattcaaaatgtt
tatcaaattgaaaggggatacgaagatgtcgctaataaattaattaatttgggggcaaga
attaagaaagttaaaaatcaatag

DBGET integrated database retrieval system