KEGG   Borrelia garinii NMJW1: BgCN_0585Help
Entry
BgCN_0585         CDS       T02299                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BgCN_0585
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BgCN_0585
Enzymes [BR:bgn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BgCN_0585
Two-component system [BR:bgn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BgCN_0585
Bacterial motility proteins [BR:bgn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BgCN_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
579991..581148
Genome map
AA seq 385 aa AA seqDB search
MKILVIDIQGLIKQVFIRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNNISLPVVFIAQNEMFPNFGCLEQSKEKVKLIINKLNFKLTVDLFRSKYLA
LIKLELRNLGKNKLVSSYEVKRISAPDFSSHSKVELRENSLDDSSIRKSYRVSDVINFAP
KNDPDVIIKYQGLLNKHKTGKIIVVGSSTGGTEALRIFLSSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYGSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGSNAIGVILTGMGDDGAICMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSKIADHVLRRS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattagtaattgatattcaaggtcttataaagcaggtttttattagagctttt
tctaaagataatgatgttgagatattaaatgctggctttaattctttgaatcttattaat
gtgtttttacaaaaatttccagatttagtcattattgatgagaatacggctagatctaat
tttgggaattctttgaataatgttcttaataatatatctcttcctgtggtatttattgca
caaaatgaaatgtttccaaattttggatgtcttgagcaaagtaaagaaaaggttaaatta
ataataaataaacttaactttaagcttacagttgatttatttcgtagcaagtatttagct
ttaataaagcttgagttgagaaatctaggcaaaaataaattagtatcttcttacgaagtt
aaaaggatttctgcacccgatttttccagtcattctaaagtagagttgagagaaaatagc
ttagatgattcaagtataaggaaaagttatagagtttctgatgttattaattttgctccc
aaaaatgatccggatgttattattaaatatcaaggccttctcaataagcataaaactggt
aaaattatcgttgttggctcttcaactggtggtacagaggctttaagaatttttttaagc
tcttttaaaaaagattctcccccaattattattgttcaacatatgccgggaggatttaca
aagtcttttgcaaaaaacttaaacaatgagtttaatattgatattaaagaagctgaggat
ggagacattcttcgtccaggtcttgtaataattgctaatggaagttatcatttgattgta
aaatatggtagtggaaattattttgtaaacttattagatgggccccttgttagtaggcat
aagccttctgtaaatgtactttttaggtctgctgcaatgtatgcaggctctaatgctatt
ggtgttatccttacaggtatgggagatgacggtgctatttgtatgcttgaaatgaaaaaa
aatggcgcttatactattgcccaagatcaagaaacgtctgttgtttttggtatgccaatg
gaagctataaaaataggagctgtagacaaaatccttcctttaagtaaaatagccgatcat
gttctgaggagatcttag

DBGET integrated database retrieval system