KEGG   Borrelia garinii NMJW1: BgCN_0644Help
Entry
BgCN_0644         CDS       T02299                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bgn  Borrelia garinii NMJW1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bgn00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bgn00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(646212..647807)
Genome map
AA seq 531 aa AA seqDB search
MEREKLINEMVNKMQDHELLGQMFMISYPNQSITNFVLDFISKKNLGGIKIFGWNAKNLK
NLIESINKAQKTSQNNKFKIPLFVATDQEGGLAQHIKLNTSETIGNLGIAASLSPKDSYN
TGYYIAQELSQLGINLNFAPIVDIYSDENNFTIGPRTYSDNPKIVSLFSLAFYKGQKQGG
IISTAKHFPGHGNTTLDSHINIPIINSNLLEINLNELLPYKILIQENIPVIMTGHIAYPK
LTNGENIPASSSTKIIKDILRKKLKYNNIIITDDLLMNAVKYNNESIYNTIERIVRTKSD
IFLISLNENIQKNAYNMLLGLMKKDSEIKNNIIESNKRILRIKLEYLKENKNQSDLYPNF
NKNEKIYSKEGEKFFEQSTLRGITKVRIEKEISKTKKTLIISPYYKMIAEGKKIFQNTYA
YYYNYYPLNGINPQKLDEIKKLIKKFDQVIFNLSTPGSLKYLENLKEYKDKISVIVSLTP
QHIKKLNWIKNIVIIYGTTPLTFKSGLLTLTKDFDPKGTIPLRDITNKYYP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaactaataaacgaaatggtaaacaaaatgcaagaccatgagctatta
ggacaaatgtttatgataagctatccaaatcagtcaataacaaattttgttcttgatttt
ataagtaaaaaaaaccttggtggaattaaaatttttggatggaacgcaaaaaatttaaaa
aacttaatagaaagtattaataaagctcaaaaaacatctcaaaataataaatttaaaatt
cctttatttgtagcaacagatcaagaaggggggttggcacagcacataaaattaaataca
tcagaaacaattggtaatcttgggattgcagcatctctatctccaaaagattcttacaac
acaggatattatatagcacaagagctaagtcagcttggaataaatttaaattttgcaccc
atagtagatatatatagtgacgaaaataatttcacaataggaccaagaacatattcagat
aaccctaaaatagtatcacttttttctctggccttttacaaaggacaaaagcaaggggga
ataatttctactgcaaagcatttcccaggacacggcaatactactcttgactcccatata
aatattccaataataaattctaatttactagaaataaatttaaatgaacttttgccatat
aaaatattaatccaagaaaacattcctgtaataatgacaggccatatagcatatccaaag
cttacaaatggagaaaatattcctgcatcatcctcaacaaaaataattaaagatatacta
agaaaaaaattaaaatataataacataataattactgatgacctattaatgaatgcagta
aaatacaataatgagagtatttataatacaatcgaaagaatagttagaaccaaaagtgac
atttttttaatatctttaaatgaaaatatacaaaaaaatgcttacaacatgttactaggc
ttaatgaaaaaagattcagaaataaaaaacaatattattgaatctaataaaagaatatta
agaataaaattggaatacttaaaagaaaataaaaatcaatctgatctttatcctaatttc
aataaaaatgagaaaatatattcaaaagaaggtgaaaaatttttcgaacaaagcacatta
agaggtattacaaaagtaagaatagaaaaagaaatatctaaaactaaaaaaacccttata
atatctccttattacaaaatgattgcagaaggcaaaaaaatatttcaaaatacatatgct
tattattataactattatccgttaaatgggattaatccccaaaaactcgacgaaattaaa
aaattaattaaaaaatttgatcaagtaatctttaatttatcaacacccggaagcttaaaa
tacttagaaaatttgaaagaatataaagataaaataagtgtaattgtatctcttacgcct
caacatattaaaaaattaaattggataaaaaacatagtaatcatttatggaacaacacct
ctgacatttaaatctggacttttaacactcactaaggattttgatccaaaaggaactatc
cctttaagggatattacaaataaatattatccttaa

DBGET integrated database retrieval system