KEGG   Borrelia garinii NMJW1: BgCN_0658Help
Entry
BgCN_0658         CDS       T02299                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BgCN_0658
Enzymes [BR:bgn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BgCN_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(662703..664454)
Genome map
AA seq 583 aa AA seqDB search
MIELLNINKKNYYKAQTLAKSINDENIVIFLIFLFNYYDKGHLRANIKLLAKDIQNTITL
TKDNLEKTNKSYNKSIKMLKGLEIFGNLENINNIVSLLKKNNILMEFNKLKITTPLILEN
NIYIYTQKNYREEEELIKQIIKRLENHKSELNDNEIQNIISNLNTSNLNKEQITSVRKAL
KSNFFLLSGGPGTGKTTTINYILKAINQTLNNKKKRLVAITAPTGKASLRLQTSIDYSFK
NLEIECNTIQKLLGIKFINKKNLYDEENQLNFDVIIIDEASMVDAYTFLKLLKATPITTK
LIIVGDKNQLPSVNEGNVYSSLLGIKKINNDNVEDLKENFRSNKEIYLLSKAIYKEDSTL
ICKYINDNKNIKLKEIEKINLKKDLIEYINNLYRKISTFNLKLLKESKIETILETLLENI
ILSSKNFGKFGTKTLNEIIKNYLKKTYGNFIGQIIMITKTDYKNKLFNGERGIIFNENSK
FYALFQRKNEKYKKINLDLLTNYEFSFATTIHKSQGSEYKHIKVILENNPFLTKELMYTA
ITRAKDSLEIISNKETVLKLSKKSSKRDSKILEHLNSFKEIDK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacttttaaatatcaataaaaaaaattattataaagcacaaacacttgcaaag
tccataaacgatgaaaatattgtaatatttttaatatttttatttaactactatgataaa
ggccacttaagagctaatataaagctattagcaaaagatattcaaaatacaataacatta
acaaaagacaacctggaaaaaaccaataaaagttataacaaatcaataaaaatgctaaaa
ggattagaaatatttgggaatctagaaaatattaataatatagtctcacttttaaaaaaa
aataatatactaatggaatttaataaacttaaaattacaactcccctaatcctagaaaac
aatatctacatttatactcaaaaaaactatagagaagaagaagagttaataaaacaaatt
ataaaaagattagaaaaccataaaagtgaattaaatgacaacgaaatacaaaatataata
tcaaatttaaacaccagtaatttaaataaagagcaaattacatcagtgagaaaagcatta
aaaagcaacttctttttattgagcggaggccctggaacaggcaaaaccacaactattaac
tatatcttaaaagcaattaatcaaacattgaacaataaaaaaaaaagattagtagcaatt
acagcacctacaggaaaagctagcttaagactacaaacaagtattgactattcattcaaa
aatttagaaatagaatgcaatacaatccaaaaactattgggaatcaaatttataaacaaa
aaaaatctatatgatgaagaaaatcaactaaattttgatgtaataataattgacgaagct
tcaatggtagatgcatatacttttttaaagctattaaaagcaacaccaataactactaaa
ttaataatagtaggagataaaaatcaactcccatcggtaaatgaaggaaatgtatattca
agtcttctaggaataaaaaaaataaataacgacaatgtagaagatcttaaagaaaatttt
agaagcaacaaagaaatatacttgctctcaaaagccatatacaaagaagatagtaccttg
atttgcaaatacattaatgacaataaaaatattaaattaaaagaaatagaaaaaataaac
ttaaaaaaagatctaatagaatatataaacaatttatatagaaaaatatccacttttaat
cttaaattactaaaagaatcaaaaattgaaacaatacttgaaactttgcttgaaaatata
attttaagttcaaagaattttggaaaatttggaactaaaacactaaatgaaataataaaa
aattacctaaaaaagacctatgggaactttattggtcaaataataatgataactaaaact
gactataaaaataaattatttaatggagaacggggaatcatttttaatgaaaattctaag
ttttatgccttatttcaaagaaaaaatgaaaaatataaaaaaataaatttagatttacta
acaaattatgaattcagctttgctacaacaatacacaaaagccaaggatctgaatacaaa
catataaaagtaatattagaaaataacccttttttgacaaaagaacttatgtatactgca
ataacaagggccaaagatagtttagaaataatttctaacaaagagactgttcttaagcta
agtaaaaaatctagcaaaagagattcaaaaatactagaacacttaaactcatttaaagaa
attgacaaataa

DBGET integrated database retrieval system