KEGG   Borrelia garinii NMJW1: BgCN_0754Help
Entry
BgCN_0754         CDS       T02299                                 

Definition
diphosphate--fructose-6-phosphate
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bgn  Borrelia garinii NMJW1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BgCN_0754
   01230 Biosynthesis of amino acids
    BgCN_0754
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BgCN_0754
   00030 Pentose phosphate pathway
    BgCN_0754
   00051 Fructose and mannose metabolism
    BgCN_0754
   00052 Galactose metabolism
    BgCN_0754
  Energy metabolism
   00680 Methane metabolism
    BgCN_0754
Enzymes [BR:bgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BgCN_0754
Protein phosphatases and associated proteins [BR:bgn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BgCN_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
764881..766224
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYAGEGSSHFVNEKNKIKFSVYRNEDEGDKYED
ILLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFNQFSRKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMSGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagtttaggagaatgcaag
caaaacaatcccttgattgatttttatgctggtgagggctcttcacattttgttaatgaa
aaaaataaaattaagtttagtgtatatagaaatgaggacgagggagataagtatgaagat
attcttttagaaaaagctggacctagagaaaaaatttatttcgtgcccaggcacgttaaa
gctgctattactacttgcggtggactttgtcctggctttaacgatgttattcgttctatt
gtgcgaactttatggaaaatttatggggttcgtaatatttatggggtaaaatttggatat
caaggccttcttcctgagtcaaattcaccttttattaatcttaatccagatgttgttgat
gatattaataaatttggaggcactattcttggctcttcaaggggtggtattaaacccgtt
gaaatagttgacactttggagagaatgaacattaatatgatttttaatattggtggagat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcggttgtaggtattcctaaaactgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagaccgctgtagaacaagcggttgcagctgttgctggcgctcattttgaagct
aatagtgcttataatggcattggacttgttaaagttatggggcgggattctgggtttatt
gctgctcatactgcgctttcttctaatgatgttaatttttgtttaattccagagcttgat
tttgatatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gagagcttagaagaaattcctcatgcagtaatattgatagcagaaggagcagggcaaaag
tattttaatcagttttctcgcaaaaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcctagctatattattagaagttcgcctgctaatgctagtgattca
ctttattgtgctaggcttggttcaaatgctgtgcatgctgcaatgtctggtaagacaaaa
atgttgattagtttgtggagtacaaagtttgtgcacataccgattaagatggcagtaatt
gacagaaataaggttaatcccaatggttctttttggagagatgttctttcaagcacagga
caaccgattagcatgaagaattaa

DBGET integrated database retrieval system