KEGG   Burkholderia gladioli ATCC 10248: BM43_1210Help
Entry
BM43_1210         CDS       T03826                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bgo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BM43_1210 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    BM43_1210 (thlA)
   00640 Propanoate metabolism
    BM43_1210 (thlA)
   00650 Butanoate metabolism
    BM43_1210 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    BM43_1210 (thlA)
   00072 Synthesis and degradation of ketone bodies
    BM43_1210 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BM43_1210 (thlA)
   00310 Lysine degradation
    BM43_1210 (thlA)
   00380 Tryptophan metabolism
    BM43_1210 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BM43_1210 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BM43_1210 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BM43_1210 (thlA)
Enzymes [BR:bgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BM43_1210 (thlA)
Exosome [BR:bgo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BM43_1210 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1312101..1313288)
Genome map
AA seq 395 aa AA seqDB search
MTLNREIILAAPLRTAIGTFNGTLKDIPATDLGAHVIKAVLAQTGVDPSKLGSVVLGNVV
QAGNRMNPARQASVNGGVPVAVPALTVNRVCGSGAQAIVSAAQEVLLGTAEAAIAGGMEN
MDRAPYLLAGARRGYRMGDATMQDSVLLDGLLDAFSGEHSGWHTEDLVAEHHVTREDQDR
WAARSQQRFAEAQRAGHFAAEIVPLDVKAGKQQIEFVQDEHNRPDTTQEKLAQLRPAFRK
DGTITAGNAPGLNTGAAAMLVADRAFAEKQGIEPLARLVAWGVAGVEPGQFGYGPVPAVR
QALSRAGWSIGDIEAIEINEAFAAVPIVALRALGLAEDIVNSEGGAVAHGHPIGATGAIL
ATRLIHAMRRRGQRRGVVTLCIGGGQGIALALETL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcaaccgtgaaatcatcctggccgcgccgctgcgcaccgccatcggcaccttc
aacggcaccctcaaggacattcccgccaccgatctcggcgcccacgtgatcaaggcggtg
ctggcgcagaccggcgtcgatccttcgaaactgggcagcgtggtgctcggcaacgtggtg
caggccggcaatcgcatgaacccggcgcgccaggcctcggtcaacggcggcgtgccggtg
gcggtgccggcgctgacggtcaaccgcgtctgcggctcgggcgcccaggcgatcgtctcg
gccgcgcaggaggtgctgctgggcaccgccgaggccgcgatcgccggcggcatggagaac
atggaccgcgcgccctatctgctggccggcgcgcgccgcggctaccggatgggcgacgcg
accatgcaggacagcgtgctgctcgacggcctgctcgacgccttctcgggcgagcattcg
ggctggcataccgaggacctggtcgccgagcaccacgtgacgcgcgaggaccaggaccgc
tgggcggcgcgctcgcagcagcgtttcgccgaggcgcagcgcgcaggccatttcgcggcc
gagatcgtgccgctggacgtcaaggccggcaagcagcagatcgaattcgtgcaggacgag
cacaaccgcccggataccacccaggagaagctcgcccagcttcgcccggccttccgcaag
gacggcaccatcacggccggcaacgcgccgggcctgaacaccggcgccgcggcgatgctg
gtggccgatcgcgccttcgccgagaagcagggcatcgagccgctcgcccggctggtggcc
tggggcgtggccggcgtcgagccgggccagttcggctacgggccggtgccggcggtgcgc
caggcgctgtcgcgcgcgggctggagcatcggcgacatcgaggcgatcgagatcaacgag
gccttcgcggcggtgccgatcgtggcgctgcgcgcgctgggcctggccgaggacatcgtc
aacagcgagggcggcgcggtggctcatggacacccgatcggcgcgactggcgcgatcctc
gccacgcggctgatccacgcgatgcgccggcgcggccagcggcgcggcgtggtcacgctc
tgcatcggcggcgggcagggcatcgcgctggcgctcgagacgctgtaa

DBGET integrated database retrieval system