KEGG   Bartonella grahamii: Bgr_01840Help
Entry
Bgr_01840         CDS       T00922                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgr  Bartonella grahamii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bgr_01840 (galU)
   00052 Galactose metabolism
    Bgr_01840 (galU)
   00500 Starch and sucrose metabolism
    Bgr_01840 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Bgr_01840 (galU)
Enzymes [BR:bgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bgr_01840 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271665..272561
Genome map
AA seq 298 aa AA seqDB search
MSVRKIRKAVFPVAGLGTRFLPATKTIPKEMLTVVDKPVIQYVVDEAREAGIEHFIFVTG
RNKAVIEDYFDAQVELYTTLAECGKKEDLAHLYRLQPLPGSTSFTRQQQPLGLGHALWCA
RELVAGEPFALLLPDMLIQAKKGCLSEMISLYEKVGGGNIIAVQECDLKEAHKYGIVGKG
KQIANGFKITKMVEKPVLGTAPSNLYINGRYILQPEIFNILSTQERGTGNEIQLTDAMIR
LSNEQDFWGLQIEGRTFDCGSKAGFIEANVAFSLARADMHSHVSASLKNLLETINVEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgcgtaaaatccggaaagctgtatttccagtagcaggtcttggtacgcgtttt
cttcctgcgacaaaaacaattcctaaagaaatgctaacagttgttgataaacctgtcatt
caatatgttgtggatgaggcgagggaggctggtattgagcattttatttttgtgaccgga
cgtaacaaagcagtcattgaggattattttgatgcgcaagttgaattatacacgacactg
gctgaatgtggaaagaaagaagatcttgcacatttataccgtttacagccattaccaggg
tcaacttctttcactaggcaacagcaacctttgggattagggcatgctctttggtgtgcg
cgtgaattagttgcaggggaaccttttgctttgttattacccgatatgctgattcaagcc
aaaaagggatgtctttctgagatgattagtctttatgaaaaggtgggtgggggaaatatt
attgccgttcaggaatgcgatcttaaagaagcacataaatacggtatagttggcaaaggt
aaacagattgcaaatggttttaaaatcacaaaaatggtagagaaaccagtgttaggaacg
gcaccatcaaatttgtacatcaatggacgttatattttgcagccagaaatttttaatatt
ctttccactcaagaacgaggaacaggaaatgaaattcaattaacagatgctatgatacgg
ctttcaaatgagcaagatttttggggtttgcaaatagaagggcgcacttttgattgcggt
tctaaagctggtttcattgaagccaacgttgcattttctttggcacgcgctgatatgcac
agccatgtttctgcctcattgaaaaatttactggaaaccattaatgttgaaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system