KEGG   Bartonella grahamii: Bgr_02460Help
Entry
Bgr_02460         CDS       T00922                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bgr  Bartonella grahamii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bgr_02460
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bgr_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
346414..346977
Genome map
AA seq 187 aa AA seqDB search
MNRPRFIYFICACLCVLVIIVGISTLSNIVYDHPTSVQYYHTVAKNDTFQEKQKAPDVSL
SLNSRLRQGNFENGRKLFRQCAICHTSGRNEAGRVGPVLWEIVNRPLASAAGFAYSRALR
SHSDQKWDFITLDRYLHSPREVFPGTIMSFRGIKNDQDRADLLLYLRSLSDHPVPLPMDN
NKANEPN
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcccgagatttatttattttatttgtgcttgtttatgtgtgctggtcattatt
gtggggatttctacactcagcaatatagtttacgatcatcctacatcagtccaatattat
catacagttgccaagaatgatacatttcaagaaaaacaaaaagcacctgatgtttctcta
tcactaaatagccgtcttcgacaaggcaattttgaaaatggccgtaaactttttcgccaa
tgtgccatatgccatacttctggacgcaatgaagcagggcgtgttggtccagttctctgg
gagattgttaatcgccctttggcatcagcagcaggttttgcttattcacgggcattgcgt
tctcattctgatcaaaaatgggattttatcactttggatcgttatttacattctccacgt
gaagtttttcctgggactattatgtcttttcgtggaattaaaaatgatcaagatcgtgcc
gatcttttgctttatttacgcagtttatccgatcatcctgttcctttaccaatggataat
aataaagcgaacgagccaaattaa

DBGET integrated database retrieval system