KEGG   Bartonella grahamii: Bgr_04110Help
Entry
Bgr_04110         CDS       T00922                                 

Definition
putative type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bgr  Bartonella grahamii
Brite
Enzymes [BR:bgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Bgr_04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494632..497829
Genome map
AA seq 1065 aa AA seqDB search
MKLKFKQQEFQNDAVKSVIDLFKGQPRRNSSIFLHSEQGQLALNEFGCGNQLLISDESIL
ANLQEVQQNNKLLASKTLEQKQFSIEMETGTGKTYVYSKTIFELNQRYGFTKFIIVVPSV
AIREGVYKSLQVTREHFQAEFDNLPYRYFIYNSKDLSQIRQFASSTNIEIMIINIDAFKK
AENIINLPQDRLNGESAMRYIQDTNPIVIIDEPQSVDNTAKAKEAIASLNPLCVFRYSAT
HKDEINLLYRLTPVDAYQKGLVKQICVSSNQIEQDFNRPYIALKSVSHKHGFKARLELDI
AGKNGTVSRKTVTVRQGDDLYRVTGGRELYRGYIVSGINCMAGDEAVEFSDTEIVKFGHA
LGDVNIVELKRAQIYRTIETHLDKELRLAPLGIKVLSLFFIDEVAKYRSNDEEPALYERM
FEECYEELLAKKKYASLRTEFAQNVRNVHGGYFSQDKKGVYKDTKGDSQADDDTYNTIMR
DKEWLLSFACPLRFIFSHSALREGWDNPNVFQVCMLIEQKSNFTARQKIGRGLRLCVNQQ
GERVEDKDINVLHVMVNESFAEFVSTLQKELEADIGYKFGTLQMEELVGRIYEDVKYAAA
KVEMPQAQKIIKTLVAKDLIDEAGVVKVDQDLVASEFEAIGAEEMPRELRQEIMKKIDSG
ALINVETLQDLIYMTAVTETKILSSQEAADILVELREKALLTSAGKITDTLKAQWATGAL
DLSERFSKGQKQAVLQALEASQAMPIIRNAAREVRVKLKKQTVASPEFLSLWEKINKKTT
YRAKLNRTEFVAKAVDAVKKMVPVAPAHLVYQTAEIKLDSAGVTYEEQLLKQSTLDYSLC
ALPNIVHYLTLKLKLTAKTIIGILTKSGREHEFVKNPQAFLERIEEILNKTHVNLTIDGI
KYLKLVGKEYSVQELFTSEELVANLERTAVVSEKSVYDHVVYESSVEKEFAQSLENDPEV
RLFFKLPRSFKIATPIGSYTPDWAVFLERDGEQKLYFVLETKGANSEFDLRLKEMLKIKC
GKAHFAALQTSVAFNDQPVTNWREYKRTLPEAAHEFPSAAVVVAE
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaatttaaacaacaagaatttcaaaatgatgcggttaaaagcgttattgat
ttatttaaaggccaaccacgacggaattcttctattttcttgcattcagaacaaggacaa
ttagcgttaaatgaatttggttgtggtaatcaattattaattagtgatgaaagcatatta
gcaaatttacaagaggtgcaacagaacaataaactcttggcgagtaagacgctagagcaa
aagcagttttctattgagatggaaacgggaacaggcaaaacttatgtttatagcaagacg
atttttgagttaaatcaacgctatggctttaccaaatttattattgtcgtaccaagtgtt
gctattcgcgaaggggtatataaatcacttcaggtaacaagggagcattttcaagcagag
tttgataatctgccctatcgttattttatttataattcaaaagatctttcgcaaattcgc
caatttgcaagctctaccaatattgaaattatgattatcaatattgatgcatttaaaaaa
gcagaaaatattatcaaccttccgcaagatagactgaatggcgaaagtgctatgcgttat
atccaagatacaaatccgattgtgatcatagatgaaccgcaatcggtggataatacagca
aaagcgaaggaggctattgcgagccttaacccgctttgtgttttccgctatagtgccacg
cataaagatgagattaatcttttatatcgtttaacacctgttgatgcttatcaaaaagga
ctggtaaagcaaatttgtgtttcttctaatcagatagagcaagattttaaccgtccctat
attgccttgaaatccgtatcacacaaacatggctttaaggcgcgcttagagttggatatt
gcgggaaagaatggcactgtgagccgcaaaacagttacagtgagacaaggcgatgatctg
tatcgcgttacgggcgggcgtgagctttataggggttatattgtttcgggtatcaattgc
atggcgggggatgaagccgttgagttttctgatactgaaattgtcaagtttggccacgcg
cttggtgatgtgaatatagtagagcttaaacgcgcgcaaatttatcgcactatagaaaca
catttagataaagaattgcggcttgcgcctttagggattaaagttttatcactttttttt
attgatgaggtggctaaatatcgtagcaatgatgaagagccagcactttatgagcgtatg
tttgaagaatgttatgaagagctgttggcgaaaaagaaatatgcctccttgcgaactgag
tttgcgcaaaatgttcgaaacgtacacggcggttatttctcgcaagacaagaaaggcgtg
tataaggatacaaagggcgacagccaagctgatgatgacacttataacacgattatgcgc
gataaggagtggttattatcttttgcatgccccttgcgttttatcttttcgcattcggca
ttaagagaaggctgggataatccgaatgtgtttcaagtgtgtatgttgattgagcaaaaa
tcgaattttaccgcgcggcaaaagattggtcgcggtttgcgtttgtgtgtaaaccaacaa
ggtgagcgggtggaagataaagatataaatgtgctgcatgtcatggtgaatgaaagcttt
gctgagtttgtgagtacattgcaaaaagaattagaggcggatattggttataaatttggt
acattgcagatggaggagttggttggccgtatttatgaagatgtaaaatatgcagccgct
aaagtggaaatgccacaagcacaaaaaattattaaaacgcttgttgcaaaagatttgatt
gacgaggcgggtgtcgttaaagtagatcaagatttagtggcgagcgaatttgaagctata
ggggcggaggaaatgccacgcgaattgcgtcaagaaattatgaaaaaaattgattcaggc
gcacttattaatgttgagacgctgcaagatctgatttatatgacagctgtgacggaaaca
aaaattctgtcttcgcaagaggctgctgatatattggttgagttgcgtgaaaaagccttg
cttacatcagcaggaaaaatcacagatacattaaaagcgcaatgggcgactggggcgttg
gatttaagtgaacgttttagtaaagggcaaaagcaggctgtgctgcaggcgctagaagcg
agccaagccatgccgattattcgtaatgctgcgcgcgaggtgcgggttaagcttaaaaag
caaacagtggcttcgcccgagtttttgtccttgtgggagaagatcaataaaaaaaccact
tatcgtgcaaagcttaatcgtacagagtttgttgccaaagcagtggatgcagtgaaaaaa
atggtgccagttgcgcccgcgcatttggtttatcagacagcagagataaaactggatagt
gctggtgtgacctatgaagagcagttattaaagcagagtacgcttgattatagtttgtgt
gcactgccgaacattgtacattatctgaccttaaagttgaaattaaccgcaaagacaatt
attggtattttgacaaagagtggtcgtgagcatgagtttgtgaaaaatccacaagctttt
ttagagcgcatagaagaaatactcaataaaacccatgttaatcttacaattgatggcatt
aaatatttaaagctggtcgggaaagaatatagtgtgcaagagctttttaccagtgaagaa
cttgtggcaaatttagagcgtacagctgttgtgagtgagaagagtgtgtatgatcatgtg
gtttatgaaagcagtgtggagaaagagtttgcacaaagtcttgaaaatgatcctgaagtc
agattgttttttaaactgccaagaagttttaaaatagccactcccattggttcttatacg
cctgattgggcggtctttttagagcgggatggcgaacaaaagctttactttgtgctggaa
acaaaaggggcaaacagcgagtttgatttgcgtcttaaagaaatgctgaaaattaaatgc
ggcaaagcgcattttgctgcactgcaaacgagcgttgcatttaacgaccagccggtgaca
aattggcgtgaatataagcgtactttgcccgaagcggcgcatgagtttccaagtgctgcg
gtggttgttgcagaatga

DBGET integrated database retrieval system