KEGG   Bartonella grahamii: Bgr_04220Help
Entry
Bgr_04220         CDS       T00922                                 

Gene name
pgl
Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bgr  Bartonella grahamii
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bgr01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bgr00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
510063..510815
Genome map
AA seq 250 aa AA seqDB search
MYRMNIDRLDFETPQTLALALADRVAAELSVSVLERKRAVLAVSGGKTPELFFHYLSKAD
IDWQNIIITLVDERFVPTHDERSNEHMVRCHLLQNFAEKARFVGLYHKAITAELAAFSAA
SRINTLPKPFDVVVLGMGGDGHTASFFPDADRLKQALDLRTQALVLPLHAKSAVEPRLSL
TLPVIMQSRCIILHIEGFQKRDCFEKACQDGSEIEMPIRAVLRNSPHLVQVYWSPADNEI
SELEYERQGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaatgaatattgaccgtttagattttgaaacccctcagactttagccttggca
ttagcagatcgagtagctgcagaacttagtgtatctgttcttgagcgtaagagagcagtt
ttagcggtgtctggtggtaaaacaccagaattgttttttcattatttgtcaaaagcggat
attgattggcaaaatatcattatcactttggtcgatgaacgtttcgttcctacacacgat
gaacgttcaaatgagcatatggtacggtgtcatttgttacaaaattttgccgaaaaagcg
cgttttgtagggctttatcataaagcgattactgctgaacttgctgctttttcagcggcg
agtcgtattaatactttgcctaaaccctttgatgttgttgttttaggaatggggggtgat
ggacatacggcttctttttttcctgatgctgatcgtttaaagcaagcgcttgatctgcga
acacaagcacttgttttgccccttcatgctaagagtgctgttgagccaagactctcacta
actttgccagttattatgcagtctcgttgtattattctccatatcgaaggttttcagaaa
cgcgattgttttgaaaaagcttgtcaagatggatctgaaatagaaatgcctattcgagca
gttttgcgtaactcccctcatcttgtgcaggtttattggtcgcctgcagataatgaaata
agtgaattagaatatgagagacaaggtgaataa

DBGET integrated database retrieval system