KEGG   Bartonella grahamii: Bgr_04530Help
Entry
Bgr_04530         CDS       T00922                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bgr  Bartonella grahamii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bgr00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
551786..552694
Genome map
AA seq 302 aa AA seqDB search
MISNVQTSFQRHSYLFTPIKLNLALHVVGQRADGYHLIESLVYFSLSGDCLHYAPCENNQ
FVLTGPFAKGLVSHLDNLVIRARDFMHKTFPECAQPAFFRLVKTLPVASGIGGGSGDAAG
VISMLRQQWNLDCSYQELAKMSLVLGADVPMCLYALEYQQPLLVKGIGQEMIQLKGACSL
AIVLVNHGQEISTQTVFKALEKRHNPSLKINTDALKSVDSLVEALQETRNDLFSSALKIA
PQLAEVLSVLDECGALFSRMSGTGATCFGIFKNKQTAQQAALFIKSMHPNWFVKPIMTLG
NI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaaatgtacaaacttcgttccaaagacattcctatttatttacacctattaaa
ttgaatttagctctgcatgttgtggggcaacgtgctgatgggtatcatttaatagaaagt
ttggtttattttagtcttagcggtgattgtctacactatgcaccttgcgaaaataatcag
tttgttttgacgggaccgtttgcaaaaggccttgtgtctcatttagataatttggttatt
cgcgcacgggattttatgcataagacttttcctgaatgtgctcaacctgctttttttcgg
cttgtaaaaacattacctgttgcttcaggcattggtggtggctcaggtgatgcagctggg
gttataagcatgttgcgtcaacagtggaatcttgattgctcttaccaagaattagcaaaa
atgagcttagttcttggtgctgatgttcccatgtgtctttatgcattagaatatcagcag
ccgcttttggtcaaaggaattggtcaagagatgatacaactaaagggagcctgttctctt
gcaatagtattggttaatcatggacaagagatttcaacacaaactgtttttaaagcgtta
gagaagcgtcataatccttctttaaaaattaatacagatgctttaaagagtgttgattca
ttggttgaagctttacaagaaacgcgtaatgatcttttttcttctgcattaaaaatagca
cctcagttagctgaagtgttatctgtattagatgaatgtggcgctcttttttcccgcatg
tctggaacgggagcaacttgctttggcatttttaaaaataaacaaacagcgcaacaagca
gctctttttatcaaatcaatgcacccaaattggtttgtaaaacctatcatgactttagga
aatatctga

DBGET integrated database retrieval system