KEGG   Bartonella grahamii: Bgr_06220Help
Entry
Bgr_06220         CDS       T00922                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bgr  Bartonella grahamii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bgr_06220 (gmk)
Enzymes [BR:bgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bgr_06220 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749565..750242
Genome map
AA seq 225 aa AA seqDB search
MTVFESKLSTIKINQRRGFLFILSSPSGAGKSTISRLLLKDGQLELSVSMTTRKRRPSEV
DGLHYHFISKEEFEYKRDRDEFIEWAEVHGNYYGTLRETVENALSTGRDMLFDIDYQGTE
QLQKKMLGDTVSVFILPPSMKELVSRLHRRAEDSQDIINLRLENARTELKHWRSYDYVVI
NEDLDQSLSFIKSIYLAETVKRERCSYLDSFVDGLIAEKIDKCLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcttcgaaagtaaattgagtactataaaaataaatcaacgccgcggtttttta
tttattctctcttcaccttcaggtgctggtaaatcaacaatttctcgattacttctaaaa
gatggacaattagagctttccgtaagtatgaccacaaggaaaaggcgtcctagtgaagta
gatgggctgcattatcactttatttcaaaggaagagtttgaatataagcgtgatagagat
gaatttattgaatgggcagaagttcacgggaattattatggcactttacgtgaaactgtt
gagaacgcattgagtactggccgtgatatgttatttgatattgattatcaaggtactgag
cagctgcaaaaaaagatgctaggagacactgtatctgtttttatccttccaccatcaatg
aaagagcttgtttcgcgtttacatcgtcgagcagaagatagtcaagatatcatcaattta
cgattggaaaatgcacgaacggagttaaagcattggcgttcttatgattatgttgtgatt
aacgaagatttagatcaatctttatctttcattaaatcaatttatttagctgaaaccgta
aaacgcgagcgctgttcttatcttgactcttttgttgatgggcttattgctgaaaagatc
gataaatgtcttgattaa

DBGET integrated database retrieval system