KEGG   Bartonella grahamii: Bgr_06500Help
Entry
Bgr_06500         CDS       T00922                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgr  Bartonella grahamii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bgr_06500 (tpiA)
   01230 Biosynthesis of amino acids
    Bgr_06500 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bgr_06500 (tpiA)
   00051 Fructose and mannose metabolism
    Bgr_06500 (tpiA)
   00562 Inositol phosphate metabolism
    Bgr_06500 (tpiA)
Enzymes [BR:bgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bgr_06500 (tpiA)
Exosome [BR:bgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bgr_06500 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bgr_06500 (tpiA)
  Exosomal proteins of melanoma cells
   Bgr_06500 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790588..791352
Genome map
AA seq 254 aa AA seqDB search
MSPNTRPFLAGNWKMNGTSESLGELRAISTGVSSDLSHLFEALICVPATLLSRASDMLDG
ENLLLGGQNCHFDDHGPYTGDISAFMLKEAGASHVIIGHSERRTVYQENDAIVCAKVQAA
WRAGLVALVCIGETLEERNNNKVLDILTQQLEESLPDDATAENTIIAYEPVWAIGTGNTA
TSEDIAKVHHFIRDKVRSRFSGEGNKIRLLYGGSVKPSNAFELLSIPHVNGALIGGASLK
AIDFLTICDVCRKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaatactcggccttttcttgctggaaattggaaaatgaatggaacgagtgaa
tcgcttggagagttgcgtgctatttctacaggcgttagctctgatctcagtcatcttttt
gaggcacttatttgcgtcccagcaacgcttttatctcgtgcttctgatatgctggatggt
gaaaatctccttttgggaggacaaaattgtcattttgatgatcatggtccctatactgga
gatatttcagcttttatgcttaaagaagcaggagcaagtcatgtcattattgggcattca
gaacgtcgtacagtgtatcaggaaaatgatgcgattgtctgtgccaaagtgcaagctgcg
tggcgagcaggtcttgtggctcttgtgtgtattggtgaaacattggaggagcgtaataat
aataaagtgctggatattctcacgcagcagcttgaagaatctttaccagatgatgcaaca
gcagagaataccattatcgcttatgaacctgtttgggcgataggcaccggcaatacagca
acttcagaagatattgcaaaagtacatcatttcattcgtgataaggtgcgttctcgtttt
agtggtgaaggcaataagatacgcctgctttatggtgggtccgtaaagccatccaatgca
tttgagcttttaagcattcctcatgttaatggtgctttgataggtggagcaagcttaaaa
gcaattgattttttaactatttgcgatgtttgtcgtaaactatag

DBGET integrated database retrieval system