KEGG   Bartonella grahamii: Bgr_06750Help
Entry
Bgr_06750         CDS       T00922                                 

Gene name
gidA1
Definition
tRNA (uracil-5-)-methyltransferase Gid
Orthology
K04094  
methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
bgr  Bartonella grahamii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(819852..821264)
Genome map
AA seq 470 aa AA seqDB search
MLKTFDIPIHIIGGGLAGCEASWQIAQSGIPVVLHEMRPEKKSDAHKTDNLAELVCSNSF
RCDDSLTNAVGLLHAEMRLAKSLIMKAADANKVPAGSALAVDRDGFSKTVTTAIENHPLI
TIKREEVQEIPKAWKHVVIATGPLTSPALAQELQAITGIKALSFFDAIAPIIHTNSIDIN
ICWYQSRYDKIGPEGTGKDYLNCPLNKEQYKTFVEALKNAEKTEFRDFEKTPYFDGCLPI
EIMAERGLETLRHGPMKPMGLTNAHNPTVKPYAVVQLRQDNKLGTLYNMVGFQTKLKYGE
QIRIFRMIPGLEKAEFARLGGLHRNTYLNSPIILDQTLRLKQKKQLRFAGQITGCEGYVE
SAAIGLLAGHFAAAEYHHISPCLPPQTTAFGALLNHITGGHIIDEKAETQSFQPMNINFG
LFPPIASIRHSGKRLASKEKKLVKKQAITARALNDCIQWLADKESKSSCL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagacattcgatatcccaattcatatcatcggtggcggtcttgcggggtgtgaa
gcaagctggcaaatcgctcaatcaggaattcctgttgttttgcatgaaatgcgacccgaa
aaaaaatcagatgcccataaaaccgataatttggcagaactagtttgttcaaattcattt
cgttgcgatgattcattaacaaatgccgtagggcttttacatgctgaaatgcgattagcg
aaatcgttaattatgaaagctgctgatgccaacaaagttcccgcaggtagtgcccttgct
gttgaccgtgatggattttcaaaaaccgttacgacagcaatcgaaaaccatcctcttata
acaatcaaacgtgaagaagttcaagaaattcctaaagcttggaaacatgttgtcattgca
acgggtccccttacatcacctgcacttgctcaagaattacaagcaataaccggtataaaa
gctctttctttttttgatgcgattgcacctattatccataccaatagtattgatatcaac
atttgttggtatcagtctcgctatgataaaattggtcctgagggaacaggaaaagattat
cttaattgtcccctcaacaaagaacaatataaaacattcgttgaagcattaaaaaatgct
gaaaaaacagagtttcgtgactttgaaaaaacgccctattttgatggatgcctccccatt
gaaattatggctgagcgcggacttgaaacgttaagacacggtcctatgaaacctatgggc
ttaaccaatgcccataaccctacagttaaaccctatgctgtcgttcaattacgccaagat
aataaacttggaacgctttacaatatggtcggctttcaaacaaaactgaaatatggtgaa
caaattcgcatttttagaatgattcccggtcttgaaaaagcagagtttgcgcgtcttggt
ggtcttcaccgcaatacctacctcaactcgccaattattcttgatcaaacccttcgttta
aaacaaaaaaaacaactacgctttgcagggcaaattaccggatgtgaaggttatgtagaa
tcagcggcaatagggcttcttgctggacattttgctgctgccgaatatcatcatatttcc
ccttgcctacccccacaaacgacagcattcggagcccttttgaatcatattacgggggga
cacatcatagatgaaaaagcagaaacacagtcctttcagccaatgaatatcaatttcgga
ctctttccccctattgcttctattagacattcaggaaaacgcttagcaagtaaagaaaaa
aaattagtaaaaaaacaagccatcacagcgagagctctcaatgattgtattcagtggtta
gcagataaagaatcaaagagttcctgtttataa

DBGET integrated database retrieval system