KEGG   Bartonella grahamii: Bgr_10230Help
Entry
Bgr_10230         CDS       T00922                                 

Definition
phage related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bgr  Bartonella grahamii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1159196..1159861
Genome map
AA seq 221 aa AA seqDB search
MARKISKDCLYCLKKWEGLRLQAYQDTSGVWTIGYGHTKKAGQPTVVEGMVITEKKAETM
LLADLQQYERAVEKAVCVNLSDEQFGALVSFCYNVGIAAFQSSTLLKRLNRGDYEAVPTE
LQKWTKAGGKRLQGLVHRRVAEAGLWAKGAYVSSNYQTVETKQPTGFLKAEALAPIIGSF
SGLGGFLAGNGPIQWALAAIMVLAACTGIFFVAKRFQEHRL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaaaataagtaaagactgtttatactgtttaaaaaagtgggaaggtttgcgc
ttgcaggcttatcaagatacttctggcgtgtggaccattggttatggtcatacgaaaaaa
gccggtcaaccaacagttgttgagggtatggtgattacggaaaaaaaagccgaaaccatg
cttttagcagatttgcagcaatatgagagagcggtagaaaaagcagtttgtgtgaattta
agcgacgagcagttcggcgctcttgtttccttttgttataatgtaggtattgcagctttc
caaagctctacattgcttaaaaggcttaatcggggggattatgaagcagtaccaaccgaa
ttacaaaaatggaccaaagcgggaggcaaacgtttacaaggtcttgtacatcggcgtgta
gcagaggcagggctatgggcgaaaggggcttatgtttcttctaattatcaaacagtagaa
acgaaacaaccaacagggtttctcaaagcagaagcattggcaccgattattggttctttt
tcaggtcttggtgggtttttagcgggcaatggaccaatccaatgggctttagccgccatt
atggttttagccgcatgtactggcattttctttgttgctaaacgctttcaggagcaccgc
ctatga

DBGET integrated database retrieval system