KEGG   Bartonella grahamii: Bgr_11110Help
Entry
Bgr_11110         CDS       T00922                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bgr  Bartonella grahamii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bgr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bgr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253284..1254249
Genome map
AA seq 321 aa AA seqDB search
MIQDNFFPLFPHQHLLAIKDLSVQDLNTLLDRAEANVILSNKIDKIKSTLHGRTQINLFF
EASTRTQSSFELAGKRLGAHVMSLAIGNSSVKKGETLLDTAATLNAMKPDILVFRHNSAG
AAALLAQKVDCCVINAGDGAHEHPTQALLDALTIKRAKGRIEGLTVAICGDILHSRVARS
NILSLNALGARVRVVAPSTLLPAEITHMSVEVFNTMKEGLKNADVIMMLRLQHERMTGSF
IPSTHEYFHYFGLHKENLAYAKNDSIILHPGPINRGVEIASDIADGPQSMIHTQVEMGIA
VRMAVMEALLDSRAKISGEKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagataatttttttccacttttccctcatcaacatcttttagctattaaagat
ctaagtgtacaagatcttaatacattgcttgatcgtgcagaagcaaatgttatcctttct
aacaaaattgataaaataaaatctactttgcatggacggactcaaattaatctctttttt
gaagcctctacgcgaacacaatcttcttttgaattagcgggtaaaaggctaggtgcacac
gtgatgagtcttgcgatcggcaactcatctgtaaaaaaaggagaaacattacttgataca
gctgcaactctcaatgcgatgaagccggatatactggtttttcgccataacagtgcagga
gcggcagctttattagcgcaaaaagttgattgttgtgtcattaatgcaggtgatggtgct
catgaacatccaacacaggctttattagatgctctaaccattaaaagagcaaaaggtcgt
attgaaggattaactgttgcgatttgtggagatatcttacactcacgtgttgcccgttcc
aatatcctgagtctcaatgctttgggtgctcgtgttcgtgttgttgctccctcaacactc
ttacccgcagaaatcactcatatgagtgttgaggtttttaacacaatgaaagaaggtctt
aaaaatgctgacgttatcatgatgttacgcttacagcatgaacggatgacaggttctttt
attccctctacgcatgaatatttccattattttggcttacataaagaaaatttagcctat
gccaaaaatgattccattattctgcatcctggcccaataaaccgtggtgtagagattgca
tctgacatagcagatggaccacaaagtatgattcatacacaagtagaaatgggaattgca
gtgcgtatggcggtcatggaggctttattagattcacgcgcaaagatcagtggagaaaaa
aaatga

DBGET integrated database retrieval system