KEGG   Bartonella grahamii: Bgr_11330Help
Entry
Bgr_11330         CDS       T00922                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bgr  Bartonella grahamii
Pathway
bgr00790  Folate biosynthesis
bgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bgr_11330 (folE)
Enzymes [BR:bgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bgr_11330 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ACS51388
UniProt: C6ADY3
Position
complement(1277410..1278030)
Genome map
AA seq 206 aa AA seqDB search
MRNIVKEDAKDSFLSEEKRPSIEEVEEAIRTLLLWIGENPNREGLLDTPRRIAKAYRELF
SGYSQSVKETLGTVFEEVSGYNEAVIVKNIPFYSHCEHHMIPIIGKAHIAYLPNEKIVGL
SKIVRVVDTFSRRLQTQEAMTAQVAHALKTYLKPHGVAVLIEAEHMCMAMRGIQKQGSTT
ITKNFHGYYEKDHVAQAHFMMMIQRS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatattgttaaagaagacgcgaaggattcttttttatctgaagaaaagcgtccg
agtattgaagaggtggaagaagcgattcgtacattactcttatggataggggaaaatcca
aatagagaagggcttttagatactccaagacgtatagccaaggcatatcgcgagcttttt
agtggttatagtcaatcggttaaagaaaccttaggtacagtttttgaagaggtttcagga
tacaatgaagctgtaatcgtaaaaaatatacctttttattcacactgtgagcatcatatg
atcccaattattgggaaagcacatatagcatatcttcctaatgaaaaaattgttggcctt
tcaaaaattgtacgtgttgtagatactttttctcgtcgtttacaaacacaagaagctatg
acagcgcaagtggcccacgcgttaaaaacgtatctgaagcctcatggtgtagcagtattg
attgaggctgagcacatgtgtatggctatgagaggaatccaaaaacagggctctacaaca
attacaaaaaactttcatggttattatgaaaaagatcacgttgcacaagcacactttatg
atgatgattcaaagatcgtag

DBGET integrated database retrieval system