KEGG   Bartonella grahamii: Bgr_11330Help
Entry
Bgr_11330         CDS       T00922                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bgr  Bartonella grahamii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bgr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1277410..1278030)
Genome map
AA seq 206 aa AA seqDB search
MRNIVKEDAKDSFLSEEKRPSIEEVEEAIRTLLLWIGENPNREGLLDTPRRIAKAYRELF
SGYSQSVKETLGTVFEEVSGYNEAVIVKNIPFYSHCEHHMIPIIGKAHIAYLPNEKIVGL
SKIVRVVDTFSRRLQTQEAMTAQVAHALKTYLKPHGVAVLIEAEHMCMAMRGIQKQGSTT
ITKNFHGYYEKDHVAQAHFMMMIQRS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatattgttaaagaagacgcgaaggattcttttttatctgaagaaaagcgtccg
agtattgaagaggtggaagaagcgattcgtacattactcttatggataggggaaaatcca
aatagagaagggcttttagatactccaagacgtatagccaaggcatatcgcgagcttttt
agtggttatagtcaatcggttaaagaaaccttaggtacagtttttgaagaggtttcagga
tacaatgaagctgtaatcgtaaaaaatatacctttttattcacactgtgagcatcatatg
atcccaattattgggaaagcacatatagcatatcttcctaatgaaaaaattgttggcctt
tcaaaaattgtacgtgttgtagatactttttctcgtcgtttacaaacacaagaagctatg
acagcgcaagtggcccacgcgttaaaaacgtatctgaagcctcatggtgtagcagtattg
attgaggctgagcacatgtgtatggctatgagaggaatccaaaaacagggctctacaaca
attacaaaaaactttcatggttattatgaaaaagatcacgttgcacaagcacactttatg
atgatgattcaaagatcgtag

DBGET integrated database retrieval system