KEGG   Bartonella grahamii: Bgr_11600Help
Entry
Bgr_11600         CDS       T00922                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bgr  Bartonella grahamii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bgr_11600 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bgr_11600 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Bgr_11600 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bgr_11600 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bgr_11600 (adh)
   00626 Naphthalene degradation
    Bgr_11600 (adh)
Enzymes [BR:bgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bgr_11600 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1309136..1310164
Genome map
AA seq 342 aa AA seqDB search
MRALQLFDDRRLEITNISPPSSPSLGEVTVRIKAVALNHIDVWGWRGMAFAKRKIPLIIG
AEASGEVIQIGDGVEHLQLGQIVSIYGAQTCGVCQACHEGRDNLCSHVKGVYGFHLDGFA
CELVNLPARLLVPSPPQCDELQAAVAPITFGTVEHMLFDNAKLQAGETILIQAGGSGIGS
AAIQLAKHMGCTVITTVGSDEKIAKAHSLGADHVINYRKDRFEGVVRKLTQKKGVDVVFE
HVGVDTWNGSLLCMKKGARLVTCGSTSGVSAPINLMQLFQQQLKIFGSFGCRMENMKNAM
QKMAEKTVHPVIDTIVGLDEIDTALKRMESRDVFGKIILKID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcactgcaactcttcgatgatcgccggcttgaaatcactaatatttccccgcca
tcttcacctagtctaggtgaagtaactgtgcggataaaagccgttgctcttaatcatatt
gatgtatggggatggcgtggcatggcttttgcgaaaagaaaaataccactcatcattggt
gcagaagcctctggtgaggttatacaaataggagatggcgttgaacatctccaacttgga
cagattgtctcaatttatggtgcacaaacctgcggagtatgccaagcttgtcatgaagga
cgggataatctttgcagtcatgtaaagggagtctacggttttcaccttgatggatttgcg
tgtgagcttgtcaatttgccagcacgtttattagttccatcacctccccaatgtgatgaa
ttgcaggcagcggttgctccaattacttttggtaccgtagaacatatgctttttgataat
gcaaaactacaagcaggagaaacaatcctgatacaggctggtggttcaggtattggctct
gcagccattcaacttgcaaaacacatgggctgtacagttatcacaacggtaggttcagat
gaaaaaattgcaaaagcacactctcttggggcagatcatgtgattaattatcgtaaagat
cgttttgaaggtgtggtgcgtaaattaacccaaaaaaaaggtgttgacgttgtttttgag
catgttggtgtagatacatggaacggttctttgttatgtatgaaaaaaggagcacgctta
gtgacttgcggttctacctctggtgtttcagcaccaataaatctcatgcaattattccaa
caacaacttaagatattcggttcatttggctgccgtatggaaaatatgaaaaatgccatg
caaaaaatggcagaaaaaactgtacaccctgtcattgatacgattgttgggcttgatgaa
attgatacagctttaaaacgaatggagagccgtgatgtttttggtaaaattatccttaaa
atcgattaa

DBGET integrated database retrieval system