KEGG   Bartonella grahamii: Bgr_11600Help
Entry
Bgr_11600         CDS       T00922                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bgr  Bartonella grahamii
Pathway
bgr00010  Glycolysis / Gluconeogenesis
bgr00071  Fatty acid degradation
bgr00350  Tyrosine metabolism
bgr00625  Chloroalkane and chloroalkene degradation
bgr00626  Naphthalene degradation
bgr01100  Metabolic pathways
bgr01110  Biosynthesis of secondary metabolites
bgr01120  Microbial metabolism in diverse environments
bgr01130  Biosynthesis of antibiotics
bgr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bgr_11600 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Bgr_11600 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bgr_11600 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bgr_11600 (adh)
   00626 Naphthalene degradation
    Bgr_11600 (adh)
Enzymes [BR:bgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bgr_11600 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 YjeF_N MAF_flag10 NADH_4Fe-4S TrkA_N adh_short ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ACS51414
UniProt: C6AE09
Position
1309136..1310164
Genome map
AA seq 342 aa AA seqDB search
MRALQLFDDRRLEITNISPPSSPSLGEVTVRIKAVALNHIDVWGWRGMAFAKRKIPLIIG
AEASGEVIQIGDGVEHLQLGQIVSIYGAQTCGVCQACHEGRDNLCSHVKGVYGFHLDGFA
CELVNLPARLLVPSPPQCDELQAAVAPITFGTVEHMLFDNAKLQAGETILIQAGGSGIGS
AAIQLAKHMGCTVITTVGSDEKIAKAHSLGADHVINYRKDRFEGVVRKLTQKKGVDVVFE
HVGVDTWNGSLLCMKKGARLVTCGSTSGVSAPINLMQLFQQQLKIFGSFGCRMENMKNAM
QKMAEKTVHPVIDTIVGLDEIDTALKRMESRDVFGKIILKID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcactgcaactcttcgatgatcgccggcttgaaatcactaatatttccccgcca
tcttcacctagtctaggtgaagtaactgtgcggataaaagccgttgctcttaatcatatt
gatgtatggggatggcgtggcatggcttttgcgaaaagaaaaataccactcatcattggt
gcagaagcctctggtgaggttatacaaataggagatggcgttgaacatctccaacttgga
cagattgtctcaatttatggtgcacaaacctgcggagtatgccaagcttgtcatgaagga
cgggataatctttgcagtcatgtaaagggagtctacggttttcaccttgatggatttgcg
tgtgagcttgtcaatttgccagcacgtttattagttccatcacctccccaatgtgatgaa
ttgcaggcagcggttgctccaattacttttggtaccgtagaacatatgctttttgataat
gcaaaactacaagcaggagaaacaatcctgatacaggctggtggttcaggtattggctct
gcagccattcaacttgcaaaacacatgggctgtacagttatcacaacggtaggttcagat
gaaaaaattgcaaaagcacactctcttggggcagatcatgtgattaattatcgtaaagat
cgttttgaaggtgtggtgcgtaaattaacccaaaaaaaaggtgttgacgttgtttttgag
catgttggtgtagatacatggaacggttctttgttatgtatgaaaaaaggagcacgctta
gtgacttgcggttctacctctggtgtttcagcaccaataaatctcatgcaattattccaa
caacaacttaagatattcggttcatttggctgccgtatggaaaatatgaaaaatgccatg
caaaaaatggcagaaaaaactgtacaccctgtcattgatacgattgttgggcttgatgaa
attgatacagctttaaaacgaatggagagccgtgatgtttttggtaaaattatccttaaa
atcgattaa

DBGET integrated database retrieval system