KEGG   Bartonella grahamii: Bgr_11660Help
Entry
Bgr_11660         CDS       T00922                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bgr  Bartonella grahamii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bgr_11660
Enzymes [BR:bgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bgr_11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314041..1314958
Genome map
AA seq 305 aa AA seqDB search
METPIYPIDWASTLPNIHHGTLKIAIDHEIRFAITYPEVEKSKGTIVILKSYASTLEKYF
LLINEISKRGFHTAIFDWFDQEKKSFKIRKQSRHHCFDINNDINDLYKFLKNIVYPNCPP
PYSMLAYGIGGLIALSGLDLINYQFNKLLCVSPLFAPFGNKTNGFQHKLTQFLSDIALGF
IPAKDGKKLNKKKQSNIKSEHMHKVPFHSIKPPTSQWMASVFNAIDSMKRNVLHGDLRIP
TLFILANQNNIANNIEVRQLCQHTRLTESITITGAKLDTIMVNENYKKQFWAAFDAFIPD
NVFVK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacacctatttatcccatagactgggcttccactcttcctaatatccatcatggt
actcttaaaatagcaatagatcacgaaattcgttttgcgataacatatcctgaggtggaa
aaatctaagggaacaattgttattctcaaaagctacgcaagtactttagaaaaatatttt
ttattaataaatgaaatttctaaacgcggttttcatacagcaatatttgactggtttgat
caagaaaaaaaatccttcaagataagaaaacaaagccgacatcattgttttgatataaat
aatgatattaatgacttatataaatttcttaaaaatattgtttatcctaattgtccgcct
ccttactctatgctcgcctatggtataggtggattgatagcacttagcggattagatctc
attaattatcagtttaataaattgctctgtgtttctcccctttttgctccattcggtaat
aaaacgaacggttttcaacataaattaacacaatttctttctgatatagctcttggcttt
ataccagcgaaagatgggaaaaaattaaacaaaaaaaaacaaagtaatataaaatcggaa
cacatgcataaagtgccgttccattccattaagcccccaacatcccaatggatggcatcg
gtatttaatgcgatcgattctatgaagagaaatgtactccacggagatttacgaattcca
acactctttattctagccaatcaaaacaatattgcaaacaacattgaagtgcggcaatta
tgccaacacacacgcctgacagaaagtattactattacaggcgctaaactggatacaatt
atggttaacgaaaattataaaaagcaattttgggctgcatttgatgcatttattcccgat
aatgtatttgtaaaataa

DBGET integrated database retrieval system