KEGG   Bartonella grahamii: Bgr_19380Help
Entry
Bgr_19380         CDS       T00922                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bgr  Bartonella grahamii
Pathway
bgr00020  Citrate cycle (TCA cycle)
bgr00190  Oxidative phosphorylation
bgr00650  Butanoate metabolism
bgr01100  Metabolic pathways
bgr01110  Biosynthesis of secondary metabolites
bgr01120  Microbial metabolism in diverse environments
bgr01130  Biosynthesis of antibiotics
bgr01200  Carbon metabolism
Module
bgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bgr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bgr_19380 (sdhD)
   00650 Butanoate metabolism
    Bgr_19380 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Bgr_19380 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS AftA_N
Motif
Other DBs
NCBI-ProteinID: ACS52030
UniProt: C6AAU1
Position
complement(2233208..2233594)
Genome map
AA seq 128 aa AA seqDB search
MKKDFRTELGKVRGRGSAHEGTEHFWLQRLTGLVNLPLLIFFIVLILSLVGKDYSIVRAR
LAHPVVAILMGLMTFSVLYHMKLGMQVVIEDYIPREGFRIFFLTLNISFCFLIGGVIIFS
LLKIALGG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagattttcgaacggaacttggaaaagtacgggggcgtgggagtgctcatgaa
ggaacagagcatttttggctacagcgtttgactgggcttgtcaatctgccgcttttgata
ttttttattgttcttattctttcgcttgtaggcaaggattatagcattgtgcgtgcacgg
cttgcacatcctgttgtggctattttgatgggattaatgactttttcagtcctttatcat
atgaagcttggtatgcaagtggtcattgaagattatattccacgtgaaggttttcggata
ttctttttgacgttgaatatttcattttgttttctcataggtggtgtcattattttttct
cttttgaaaattgcattagggggttaa

DBGET integrated database retrieval system