KEGG   Bartonella grahamii: Bgr_20110Help
Entry
Bgr_20110         CDS       T00922                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bgr  Bartonella grahamii
Pathway
bgr00020  Citrate cycle (TCA cycle)
bgr00310  Lysine degradation
bgr01100  Metabolic pathways
bgr01110  Biosynthesis of secondary metabolites
bgr01120  Microbial metabolism in diverse environments
bgr01130  Biosynthesis of antibiotics
bgr01200  Carbon metabolism
Module
bgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bgr_20110 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Bgr_20110 (sucB)
Enzymes [BR:bgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bgr_20110 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF3739 TFIIF_alpha
Motif
Other DBs
NCBI-ProteinID: ACS52096
UniProt: C6AB07
Position
complement(2317218..2318429)
Genome map
AA seq 403 aa AA seqDB search
MTTEIRVPTLGESVTEATIGKWFKKLGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII
AKEGDTVEVNALLGVVEAGEAGVSQSFSPSATLVPAASSESEKPASGSTMPPSPSAAKLM
AENNVAKSDISGSGKRGQILKEDVLGGLKQSTNAPTPSSSATSSSATPVQETREERVRMT
KLRQTIARRLKDAQNVAAMLTTFNEVDMSAVMDLRKRYKDLFEKKNGVKLGFMGFFTKAV
CHALKELPAVNAEIDGTDIVYKNYVNVGIAVGTDKGLVVPVVRDADQMSLAEIEKEIGRL
GRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHAIKERAMVVEGQV
VIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERLVLDL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaaattcgtgttcctactttgggcgaatcggttaccgaagcaacgattggc
aaatggtttaaaaaacttggcgaagctgtcgctatggatgagcctttggttgaattagaa
actgataaggtgaccgttgaagttccttctcctgttgcaggaaaattatctgaaatcatt
gcaaaagaaggcgatacggttgaagtaaatgctcttttaggagtggtggaagctggagaa
gctggtgtctcccaatcattttcaccttctgctacacttgttccagcggcttcatctgaa
tcggagaagcctgcttcgggcagtacaatgcctccttctccttcagcagcaaaattgatg
gctgaaaataatgttgcaaaaagcgatatttcaggttctggaaaacgtggacaaattctt
aaagaagatgttcttggtggattaaaacaaagtacaaatgcccctacaccctcttcttct
gcgacgagttcttcggcaactcctgtccaagaaacacgtgaagagcgggttcgtatgacg
aaattgcgtcaaacaattgctcgccgtcttaaagatgcacaaaatgtagcagcaatgtta
accacatttaatgaggttgatatgtcagcggtgatggatttgcgcaagcgttataaggac
ctttttgaaaagaaaaatggtgttaaacttggttttatgggtttttttaccaaagctgtt
tgtcatgcattaaaagaacttcctgctgttaatgccgagattgatgggacagatattgtt
tacaaaaactatgtcaatgttggaattgctgttggaacggataaggggcttgttgttcca
gtagtgcgagatgcagatcaaatgtcattggcagagattgaaaaagagattggtcgtttg
gggcgtcttgcgcgtgatggaaaattagccgtttctgatatgcaagggggaacttttacc
attaccaacggtggtgtgtatggatcgttgatgtcaacaccgattttgaatgcaccacaa
tctggtattttgggaatgcatgcgattaaagagcgagcaatggttgttgagggccaagtt
gtgatccgccccatgatgtatttagcgctttcttatgatcaccgtattgtggatgggcaa
gaagctgtaactttccttgtgcgtgttaaggaaagcttagaagatccggaacgccttgtt
cttgatttgtaa

DBGET integrated database retrieval system