KEGG   Bacillus glycinifermentans: BGLY_4373Help
Entry
BGLY_4373         CDS       T04537                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgy  Bacillus glycinifermentans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bgy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BGLY_4373 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BGLY_4373 (mmgA)
   00640 Propanoate metabolism
    BGLY_4373 (mmgA)
   00650 Butanoate metabolism
    BGLY_4373 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    BGLY_4373 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BGLY_4373 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BGLY_4373 (mmgA)
   00310 Lysine degradation
    BGLY_4373 (mmgA)
   00380 Tryptophan metabolism
    BGLY_4373 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BGLY_4373 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BGLY_4373 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BGLY_4373 (mmgA)
Enzymes [BR:bgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BGLY_4373 (mmgA)
Exosome [BR:bgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGLY_4373 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(4225287..4226468)
Genome map
AA seq 393 aa AA seqDB search
MMVRTVIIDGARTPFGKLGGSLQPKTASELGGIAIREALKRSGVRPEDVDEVIMGTVLQG
GQGQLPSRQAARHAGLPWDVKTETVNKVCASGLRSVTMADQIIRAGDADVIVAGGMESMS
NAPYALTKARWGLRMGDGSVKDLMILDGLTCSFTGVHMGSYGNSAARELEITREEQDRWA
LRSHMRAVRAAASGALGEEIVPVNIREKRGGELTVKHDESPRSDTSIERLAALAPVFDRD
GTITAGNAPGVNDGACAFTVMSDEKAKSLNLKPYAVMTAHASIAVEAKDFPKTPGLVINE
LLKKTGAELSDISLFEINEAFAAVALASGQIAGLDMEKVNVNGGAIALGHPIGASGARIL
LTLMYELKRRGGGTGIAAICSGGGQGDAVMIQV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcagaacggttattatcgatggagcgcgcacgcctttcggaaaactgggcgga
tcacttcagccaaaaacggcgtcagaactcggaggcattgccatcagagaagcgctgaaa
cggtcaggtgtcaggcctgaggatgtagatgaagttattatggggaccgttctgcaaggg
ggccagggacagctgccgtcaaggcaggcggcaaggcatgccggtcttccgtgggacgtt
aaaacggaaacggtcaataaagtatgcgcatcaggcttaagaagcgtgacaatggcggat
cagatcatccgcgccggcgatgccgacgtcattgtcgcaggcgggatggagtcgatgtca
aatgcgccttatgcgctgacaaaagcgagatggggcctgaggatgggagacgggtctgtt
aaggacttgatgatccttgacggattgacctgctcatttacgggggtgcatatgggctca
tatggaaattctgcggcaagagaattagagattacgagagaggagcaggaccgctgggcg
ctgcggagccatatgcgggcggttcgggccgccgcctcaggcgccctcggagaagagatc
gttcccgtcaacattcgcgaaaagcggggcggagagctgacggtgaaacatgatgaatcc
ccgcgcagcgacacatcgatcgaacggctggccgcgctggcgcccgtctttgaccgcgac
ggcacgattacggcgggcaatgccccgggcgtaaatgacggggcgtgtgcattcaccgtc
atgagcgatgaaaaggcaaagtctttgaatctgaagccttatgccgtcatgacggcgcat
gcttccatcgcagttgaagcaaaagactttccgaaaacacccgggcttgtcatcaatgag
ctgctgaaaaaaacgggggcggagctttcggatatcagcctgtttgaaatcaatgaggct
tttgcggcggtcgctctggcaagcggacaaatcgcagggctcgatatggaaaaggttaat
gtcaacggcggcgcgattgcgcttggccatccgatcggcgccagcggggcaaggatcctt
ttgacgcttatgtacgaattaaaacggcgcggcggcggtacgggaattgccgcgatttgc
agcggcggcggacagggagatgccgtcatgatccaagtttaa

DBGET integrated database retrieval system