KEGG   Bacillus halodurans: BH0215Help
Entry
BH0215            CDS       T00039                                 

Definition
(GenBank) pyruvate dehydrogenase E2 (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bha  Bacillus halodurans
Pathway
bha00010  Glycolysis / Gluconeogenesis
bha00020  Citrate cycle (TCA cycle)
bha00620  Pyruvate metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Module
bha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH0215
   00020 Citrate cycle (TCA cycle)
    BH0215
   00620 Pyruvate metabolism
    BH0215
Enzymes [BR:bha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BH0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H PTS_EIIA_1 RepB-RCR_reg
Motif
Other DBs
NCBI-ProteinID: BAB03934
UniProt: Q9KG97
Position
230718..231962
Genome map
AA seq 414 aa AA seqDB search
MVEFRLPDVGEGMHEGEIISWFVQEGDHVKQDEPVVEVQTDKMNAELTAPVSGKIKRVYY
KVGEVAEVGSLLFTIDENLSTFKSETHERTKRENSTEQTRPISNISLTSQQKAPVRKGLA
TPYVRQLAREMNINLEDVVGTGPGGRVLEQDLQNDTNLQKVKTVPSGVANVQESIERTGS
SAEKRIPLKGIRKAIAEKMIKSVATIPHVTHVDEIEMDALKELREQLKHYSEQKGIKLTF
LPFFIKAIVSALKEFEYFNASIDEETNEIVLKKDYHIGIATDTEKGLIVPVIQNADQKSL
LELAGEITQLSTQARKGTLNVQQMTGSTFTISNVGPIGGLHATPIINYPEVAILALHKME
PRNVVREWESVIKLMMNMSLSFDHRLVDGATAVRFTNRMKELIENPNLLLMELR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatttagactacctgatgtaggggaagggatgcatgagggagaaattattagc
tggtttgttcaagaaggagaccatgtcaaacaggatgagccggttgttgaagttcaaacc
gataagatgaatgcagagttaacagccccagtatcaggtaaaataaaacgagtttattat
aaagtaggagaagtagcagaggtggggtcgttgttattcacaattgacgagaacctatca
acctttaaatccgaaacacatgaacgaacaaaacgagaaaacagcactgaacaaacacgt
ccaatctctaacattagtttgacgtcacaacaaaaagcccccgttagaaaaggattggct
actccctacgtaagacagttagcgagggaaatgaatattaatttagaagacgttgtcggt
acaggacctggggggagagtgttagagcaagatttacaaaacgatacgaatctacaaaaa
gttaaaacggtgccatcgggagtggcgaatgttcaggaaagcatcgaacgaacaggatca
tctgcggaaaagcgcattcctttgaaaggaattcgtaaagcaattgcagagaagatgata
aaatctgttgctacgattccacacgtgacacacgttgatgaaattgaaatggatgcttta
aaggagctccgtgagcagttaaaacattacagcgaacagaaagggataaagcttacgttt
ctacctttttttataaaagcaattgtaagcgctttaaaagagtttgagtattttaatgct
tcgattgatgaggagacaaatgaaattgtgttaaagaaagactatcacattgggattgcc
acagatacagaaaaggggctcattgttccagtcattcaaaatgccgatcaaaaaagcttg
ctagagctggcaggagaaattactcaattgtctactcaagcaagaaaaggaacgttaaat
gttcagcagatgaccggaagtacatttacgattagtaatgtcggtccaatcggcggtctg
cacgctaccccaatcattaactatccggaggtggccattcttgcattgcataaaatggag
ccgcgaaacgttgtgagagagtgggagagtgtaataaaactcatgatgaatatgtcttta
tcgtttgaccacaggttagtggacggggcaacagctgttcgtttcacaaatcgcatgaaa
gagctcattgagaatccaaacttactattaatggagttgaggtaa

DBGET integrated database retrieval system