KEGG   Bacillus halodurans: BH0603Help
Entry
BH0603            CDS       T00039                                 

Definition
endo-beta-1,4-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bha  Bacillus halodurans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BH0603
Enzymes [BR:bha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BH0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642042..643766
Genome map
AA seq 574 aa AA seqDB search
MKWMKSMAWLAVVLVVSFVAPAVSSAHEDVKTLDIQSYVRDMQPGWNLGNTFDAVGQDET
AWGNPRVTRELIEQIADEGYKSIRIPVTWENRIGGAPDYPIDPQFLNRVDQVVQWALEED
LYVMINLHHDSWLWIYEMEHNYNGVMVKYRSLWEQLSNHFKDYPTKLMFESVNEPKFSQN
WGEIRENHHALLDDLNTVFFEIVRQSGGQNDIRPLVLPTMETATSQPLLNNLYQTIDKLD
DPNLIATVHYYGFWPFSVNIAGYTRFEENSKQEIIEAFDRVHHTFVARGIPVVLGEFGLL
GFDKHTGVIQQGEKLKFFEFLIHHLNERDITHMLWDNGQHFNRHTYEWYDQELFDMMRAS
WEGRSSVAESNFIYLKQGDRIADATVSLQLHGNELTGLRANGQRLTPGQDYELNGERLTV
KAHVLSAIASSGTLGTNGMVTAEFNRGADWHFRVNTYRTPVLQSTQGHVSNFSIPASFNG
NSLATMEAVYVDGGNAGPQDWTSFKEFGYAFSPSYDANEMKLTEAFFREVRDGEVRLTFH
FWSGETVNYTIIKNGNQVTGIAAQTTNSKNKNKK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggatgaaatccatggcatggttggccgttgttttggtcgtttcgttcgtagct
cctgccgttagttctgctcatgaggatgtgaaaactctcgatattcagtcctatgtaaga
gacatgcagccgggttggaatcttgggaatacgtttgatgccgttggacaagatgaaact
gcatggggaaatccacgtgtgacacgagaattaattgaacagattgcggatgaagggtat
aaaagcattcggattccggtgacgtgggaaaatcgtatcggaggggcacctgattatcct
attgatcctcagtttttaaatcgagtggaccaagtggttcaatgggcgctggaagaagat
ttgtatgtcatgattaatttacaccatgattcatggttatggatttatgaaatggagcac
aactacaatggtgtaatggtcaagtatcgctcgctctgggagcaactatcgaaccacttc
aaagactatccaacaaagcttatgtttgaaagtgtcaatgagccaaagtttagtcaaaac
tggggcgagatccgtgaaaatcaccatgcgttactagatgacttaaacacagtctttttc
gagattgtgagacagtctggtggccaaaatgatatccggccgttagtgttaccaactatg
gaaacagccacatcacaaccgttgctaaacaacctttatcaaacgatcgacaaattggat
gatcccaacctcattgcgacggtacactattacgggttttggccttttagcgtgaatatc
gctggctacactcgctttgaagagaattcgaaacaggagatcatcgaagcgtttgatcga
gtacaccatacatttgttgcaagaggaattccagtcgttctaggtgagttcggcttgctt
ggatttgataaacatactggagtgattcaacaaggtgaaaagctaaagttctttgagttt
ctcatccatcatttgaacgagcgggatattacccatatgctttgggataatgggcagcat
ttcaatcgtcatacgtacgaatggtatgaccaggaattgtttgacatgatgcgggcaagc
tgggaaggacgatcgtccgttgccgagtcaaactttatctatttaaaacagggagaccga
atcgcagatgcaacggtatctttacaattgcacggaaatgaattaacagggctccgggcc
aatgggcagcgactaacgccggggcaggactatgagttaaatggagaaaggcttacggtg
aaggcccatgtcctatcggcaatcgctagttcaggtacgttaggtacgaatggcatggta
acggctgaatttaatcgtggagcagattggcattttcgggtgaatacgtatcgtacgcct
gtattgcaaagcacgcaaggtcacgtgagtaacttcagcattcctgcttcctttaatggg
aatagcttagcaacaatggaggccgtctatgtggatggcggaaatgctggcccgcaagac
tggacttcctttaaggagtttggctatgccttctctccttcatatgatgcaaatgagatg
aaactgactgaggcgttttttcgtgaggtgcgggatggtgaagttcggttaaccttccat
ttttggagtggtgaaacagtcaactatacgattattaaaaacgggaaccaggtgactggg
atagcagctcagacaaccaattcaaaaaacaaaaataaaaaataa

DBGET integrated database retrieval system