KEGG   Bacillus halodurans: BH0675Help
Entry
BH0675            CDS       T00039                                 

Definition
beta-hexosamidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bha  Bacillus halodurans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BH0675
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BH0675
Enzymes [BR:bha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BH0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(728850..730910)
Genome map
AA seq 686 aa AA seqDB search
MKFGLALSLIIAITMCFAPSSVVEAKRSSSFLLLENVPGFLPSPSGDSIRFTPLTIEDGA
LVKTYQEVSWRSSNRKVATVDNKGTVTLTGKPGRTFIHATHGSSSDRIAIHVTPKKGVTL
IQEKGPQYDVIETLLDQMTLEEKIGQMMMPDFRTWNGQNVVEMLPEIEQMVKEYHLGGVI
LFRENVVETEQIIHLVNDYQDAAEKLGLLITIDQEGGIVTRLQNGTDLPGNMALGATRSE
GLASQAGTVIGRELQSLGINMNLAPVLDVNNNPDNPVIGVRSFSENPELVGQLGVAYTKG
LQSTGVAATAKHFPGHGDTDVDSHLGLPEVPHDRARLDEVELAPFRQAMAEGIDAIMTAH
VTFPAIDDTKVISEKDGSLISLPATLSEKVLTDLMRDDLGFEGVIITDAMNMNAISDHFG
PTDAVIRSINAGADIILMPVGLQTVFPAVVEAVENGEISEERVNEAVKRILTLKLNRGIL
KTDSSTSIDEQIAEAERVIGSDDHRQIEQQIAEQSITVIKNEQDTLPLSVEEDDYVVVVG
STYSENLAAAFEDASVQTEHILLSSNQSSLTAEQQDLVEGASAIIIASHSANIAGRSPSH
PHMQLYVSLSESADQPVVAVAIRNPYDIMAYPSVPAYIAQYGFRDASFRASVRTIVGDLT
PSGQLPVTIPTIEGDVMFEYGHGLSW
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttggacttgctctatcgctcatcatagccattacgatgtgctttgccccgtca
agtgttgtcgaagcaaaacgatcatcttcttttctactgctggaaaatgtacctggcttt
ctgccatccccttctggagactcaattcgcttcacaccattaacgatagaggacggggcg
ttagtcaaaacctatcaagaggtaagctggcgctcgtccaatcggaaagttgccactgtt
gataacaagggaactgtcacactcacaggcaagcctggccggactttcattcacgccaca
cacggttcatcctctgaccgaatcgccatacacgtaacgccgaaaaaaggggtcacgctc
attcaggaaaaaggtccgcaatacgatgtcatcgaaacgctcctcgaccaaatgacgctc
gaagaaaaaattggacaaatgatgatgcctgacttccgtacttggaacgggcagaatgtg
gtggaaatgcttccggagattgaacaaatggtgaaggaatatcatctcggcggcgtgatc
cttttccgtgaaaatgttgtagaaaccgagcaaataatccatcttgtaaacgattatcaa
gacgcagcagaaaagctcggactgctcatcacgattgaccaggaaggtgggattgtgacg
cgccttcaaaatgggacagatctcccgggaaacatggcgctcggagctacccgttcagag
ggtttagcctctcaagctggaactgtcattggccgggagctacagtcactcgggattaat
atgaacctcgcacccgttctcgatgtgaacaacaatccagacaacccagtgatcggggtt
cgatccttttcggaaaaccctgagcttgtcggccaattaggagtcgcctacacaaaggga
ctacaatctacaggagtcgctgctactgctaaacattttcccggacatggggacaccgat
gttgattctcacttagggttaccagaggtgcctcatgatcgggctcgactagatgaagta
gagcttgctcctttccgtcaagcgatggccgaaggaatcgatgccatcatgaccgcccat
gttacgttcccagccattgacgatacaaaagtgatctcagagaaggatggctcacttatt
tccttaccagctacattatcggaaaaggtgctcaccgatttaatgcgtgacgacctcggc
tttgaaggggtgatcattaccgacgcgatgaacatgaacgcgatcagtgatcattttggc
ccaacggatgcagtcattcgttcgatcaatgctggggcggatattattttaatgccagtc
ggcttacagacggtgtttcctgcggtggtggaagccgtggagaatggagaaatttccgag
gagcgcgtgaacgaagcggtaaaacgcattttaacattgaagctgaaccgaggcatcctt
aaaacggactcctcaacatcgattgatgagcagatcgcggaggctgaaagagtgatcggc
tcagacgaccaccgccagatcgaacaacaaatcgccgaacaatccataaccgtgataaaa
aatgaacaagacacgcttcctctatccgttgaagaggatgactacgtcgttgtcgttggt
tccacctatagtgaaaacttagcagctgcctttgaagacgcctctgttcaaacagaacat
attttacttagtagcaaccaatcgagcttgaccgccgaacagcaagaccttgtagagggg
gcctctgccatcatcatcgcttctcattcggctaacatcgctggtcgctcaccgtcacat
cctcacatgcagctatatgtgtcgttgagtgaatcggctgatcaaccagtagtcgctgtt
gcgattcgtaatccatatgacatcatggcctacccttccgttccagcatacattgctcaa
tatggatttcgtgatgcaagcttccgcgcctccgtacggacgattgtcggtgacctcacg
ccgtctggacaattgccagtaacgattccgacaattgagggtgatgtgatgtttgaatat
ggccatgggttatcatggtaa

DBGET integrated database retrieval system