KEGG   Bacillus halodurans: BH0684Help
Entry
BH0684            CDS       T00039                                 

Gene name
alp
Definition
prepro-alkaline protease
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bha  Bacillus halodurans
Brite
Enzymes [BR:bha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BH0684 (alp)
Peptidases [BR:bha01002]
 Serine Peptidases
  Family S8: subtilisin family
   BH0684 (alp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740001..741119
Genome map
AA seq 372 aa AA seqDB search
MKRRVHVLIMTILMIVLATGTAFADNREDTEDTEEYLVGFKNEAAVQAFSNNVTTSAVEV
QHEYENLPVIVSELSTEVAQLLENDPSVEFIEKNERVYLDPLVMNNIQETDIPKLEERMK
RGDGVKIAVLDTGIASHDDLHVIDGVSFVSVEPFYRDLNGHGTHVAGTIAAQENDEASTG
IAPNVELYAVKVLNGLGAGSIASITNGVDWAISNDMDIINMSLGTNTDSEALQRAVERAH
DHGILIIAAAGNSGEADKQHTIDYPARYDSVVAVGAVDGNNERASFSSYGEQLEIMAPGV
EIHSTFLFNRYERLSGTSMASPHVTGAAALIKSNNPELTNEQIRKRLNTTATPLGNPFYY
GHGLLNVDAALD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacgtgtacacgtgttgatcatgaccatattgatgatcgttctggcgactgga
acagcttttgcagacaatcgtgaagatacagaagatacagaggaatatttggtcggcttt
aaaaatgaagcggccgttcaagccttcagtaacaatgtcacgacctcagcggtagaagtg
cagcacgaatacgaaaaccttcctgtcatcgtgtcagagctttccacagaagtggcccag
ttgctagaaaatgacccatcggttgaatttattgaaaagaatgaaagagtataccttgat
ccgcttgtgatgaataacatccaagagacggatattccgaaattggaagagcgtatgaag
cggggagacggggttaagatcgcggtccttgatacgggaattgcaagccatgatgattta
catgttattgacggtgtgagcttcgtatcagttgaacctttttaccgtgacttaaatggg
cacggaacccatgttgcgggcaccatcgctgcccaagaaaatgatgaagcttcgactgga
atcgcaccgaatgtggagctctatgccgtcaaagtgctgaatggtcttggtgcaggctcg
attgcctcgattacgaacggagttgactgggcgatctcaaacgatatggacatcattaat
atgagtctcggcacgaacaccgactcagaagcgttacaacgagcggtcgagcgcgcccat
gatcatgggattttaatcatcgccgccgctggtaattcaggggaagcggacaaacaacat
acgattgattacccggctcgctatgattcggttgtcgccgttggagcggtcgatggcaat
aacgagcgagcaagcttttcaagctacggggagcagcttgaaatcatggcccctggtgtt
gagattcatagcaccttcctctttaatcgatacgagcgattaagtggaacgtcaatggct
tcacctcatgtgacaggagcagcagccctcattaaaagcaacaaccctgagctaacaaac
gaacaaattcgcaagcgattgaatacaacggccacaccactcggaaatccgttttattac
ggtcatggccttcttaacgtggacgccgctttagattaa

DBGET integrated database retrieval system