KEGG   Bacillus halodurans: BH0759Help
Entry
BH0759            CDS       T00039                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bha  Bacillus halodurans
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bha00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822856..823845
Genome map
AA seq 329 aa AA seqDB search
MVSKDVVKQQKTEKRTMYYGKGDVFVYRTNASPLEGIKAIPESSFSGRKNVILGMDLKVA
LKGDAFLSSFTDGDNSLVIATDSMKNFILRKAAFFNGSTMEDFLQFISKEFLNTYSHISS
VSLSGDQLLFHEVPIPSTSGFQTSDLLFQQEESVKPFAKVEVRRMDTEYKVMEQLSGIQG
LRLIKVKESSFYGYIQDEYTTLPEAYDRPLFLYLNMFWAYENPEDATGIKPDRYVSAEQV
AAIAYTVFHEMNCPSIQNLLYQIGLRVLMRFPQLVEISFESNNRTWETVVEEAKDERGGK
VYTEPRPPYGFQGFSMTREDLLAAERAEK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgaaagacgttgtgaagcaacaaaaaacagagaaacggacgatgtattacgga
aaaggcgatgtgtttgtctatcgaacgaacgcttcacccctagaagggataaaagccatt
cctgaatcgagctttagtggaagaaaaaatgtcattctaggaatggatctgaaagtggca
ttgaaaggagatgcgttcctttcttcctttacagatggagacaactcactcgtgattgct
accgattcgatgaaaaattttattttgcggaaagcagcgttttttaatggctcaacgatg
gaggattttcttcagtttataagcaaggaatttttaaacacgtattctcatatttcgtct
gtttctctttcaggtgatcaactgttgtttcacgaagtaccgattcctagtactagtggg
tttcaaacaagcgacttgctctttcagcaagaagaatcggtcaagcccttcgcgaaagtg
gaggtgaggcggatggacacggagtataaagtaatggagcaattgagtggcattcaaggg
ttacggctaattaaagtgaaggagagctcgttttacggctacattcaggatgaatatacg
acattgccagaggcgtacgaccgaccgctctttctttatttgaacatgttttgggcgtat
gagaatccggaagatgctacgggaataaagccagatcgatatgtgagtgctgaacaagtt
gcagctattgcctatactgtttttcatgaaatgaactgtccttcgattcaaaatttgctg
tatcaaattggcctaagggttttgatgcgttttcctcagcttgtagaaatatcgtttgaa
tcaaacaatcgtacgtgggaaacggttgtagaagaagcgaaagatgagcgcggtggaaaa
gtgtatacggagcctcgtcctccttatggatttcaaggattttcgatgacgcgggaagat
ttactcgcagctgaaagggcggagaagtaa

DBGET integrated database retrieval system