KEGG   Bacillus halodurans: BH0797Help
Entry
BH0797            CDS       T00039                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bha  Bacillus halodurans
Pathway
bha00010  Glycolysis / Gluconeogenesis
bha00052  Galactose metabolism
bha00500  Starch and sucrose metabolism
bha00520  Amino sugar and nucleotide sugar metabolism
bha00521  Streptomycin biosynthesis
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Module
bha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH0797
   00052 Galactose metabolism
    BH0797
   00500 Starch and sucrose metabolism
    BH0797
   00520 Amino sugar and nucleotide sugar metabolism
    BH0797
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BH0797
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BH0797
Enzymes [BR:bha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BH0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: BAB04516
UniProt: Q9KEQ2
Position
869630..870511
Genome map
AA seq 293 aa AA seqDB search
MKVGIDLGGTKIKAALVSDAGEIISVQECPTEAAQGPEEVMNKMMSLTEKVTDHQPFAGI
GIGAPGPLSSTEGTILSPPNLPGWDHIHLVDRFQEQFQCPVKLDNDANVAALAEALLGSG
QGFTSVFYLTISTGIGGGYVLDGSIVHGASDYAGEIGNMIVQPNGYQHANLNPGSLEGLA
SGTAIGRMARERFGVEGGTREVFDQIRRGDHDMQRLVEEAMDYLAIGIANIAHTINPDVF
VLGGGVMNADDLILPIVKEKVSRYLYPGLAQSTTIVKAKLGGDSGVLGAAMLV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttggaatcgatttaggtggaacaaaaataaaagcggcactcgttagtgatgca
ggagagataatttccgtgcaagaatgcccaacggaagcggcgcaaggtccagaggaagta
atgaacaagatgatgtctttaacagaaaaagtcacggatcatcagccgtttgccggaatt
ggaattggggcaccgggtccgttaagctctacggaaggtacgattcttagtccaccgaac
ctcccaggctgggatcatattcatctagttgatcgttttcaggagcagtttcagtgccct
gtgaaattagataacgatgccaatgtggcagcactggcggaagctttgcttggaagtgga
caagggtttacgagtgttttctatttaacgatcagcacgggcattggtggcggctatgtt
ttagatgggagcatcgttcatggggccagtgattatgcaggggaaattggcaacatgatc
gttcaaccaaatggctatcagcacgcaaatttgaacccagggtcactagaggggctagca
agtggaacggctatcggacgaatggcacgagagcgtttcggggttgaaggtgggacgaga
gaggtgtttgaccagattcgccggggagatcatgatatgcaacgcttagtcgaagaagcg
atggactatttagcgatcgggatcgcgaatatcgcccatactataaatccagatgtcttt
gttcttggcggtggtgttatgaatgcggatgatctgattttaccgatcgtaaaagagaaa
gtatctcgctacctttatccaggattggcacaatcaacaacgatcgtgaaggcaaaacta
ggcggtgactcgggcgtactaggtgcggcgatgctcgtttaa

DBGET integrated database retrieval system