KEGG   Bacillus halodurans: BH0874Help
Entry
BH0874            CDS       T00039                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bha  Bacillus halodurans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BH0874
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BH0874
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BH0874
Enzymes [BR:bha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BH0874
Exosome [BR:bha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BH0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(946885..948219)
Genome map
AA seq 444 aa AA seqDB search
MKHRVHVTVLLFVMIVLILPAETVFASFVQEGTITPDSEQVKNIIYMIPDGYSASYATNY
RIYKGEEEPIWDPHLVGMVKTHSADSWVTDSAAAGTALATGTKTSNGTIGMSTEGEELES
ILQAAGKQKKGTGIVVTTRLTHATPAAFVASVPLRIDEAKIAPQMIGQVDVLLGGGKKMF
VPEAEGGMQNSRHLLNEAEDAGYALIETKEELQNVNSAKVLGLFSEGALAPELDRQGTQE
PSLAEMTEAALHTLKQNPNGFFLMVEGSQIDWAGHDNDAAWAMKDIEAFEEAVSVAFDFA
EKDGNTLVVVVGDHDTGGLSVGAYGQYKAKPDMLKQVKATGKFIASQVNKRRTNLADVMK
TYTGFELTKKELKQIKKADHLTNAINQVISRRALIGWTTPVHTGTDIPIYAFGPCSDRLH
GLLDNTDIPLILADVMDLEWEKAS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcgcgtacatgtaaccgtcttactttttgttatgattgtgcttatcttgcca
gcggaaaccgtgtttgcttcttttgttcaggagggaacaatcacacctgacagcgaacaa
gttaaaaacattatttatatgatccccgatgggtactcggctagttatgctaccaattat
cgtatttataaaggcgaggaggagccgatctgggacccccatcttgtcgggatggtaaaa
actcattcggctgacagttgggtcaccgattcggctgccgccggaactgcgctggcgaca
ggtacaaaaacgagcaacgggacgatcggtatgtccactgaaggagaagagcttgagtcc
attttacaagctgcgggaaagcagaaaaaagggacaggaatcgtcgttacgactcgactt
acccatgcgacaccagccgccttcgtagcaagtgttccattaagaatcgatgaagcgaag
attgcgccgcaaatgattggacaggtggatgtgttactagggggcgggaaaaaaatgttt
gttcccgaagcagaaggaggaatgcaaaatagccggcatctactaaatgaagcggaggac
gcgggttatgcgttgatcgaaacaaaggaagaactgcaaaatgtaaattcagcaaaggtt
ctcggcctattttccgagggagccttggcaccagagctggatcgacaagggacacaagag
ccgagcttagcagaaatgacagaagctgcgctccacacgttaaaacaaaatccgaacggc
ttcttcttaatggttgaaggaagccaaattgattgggctggtcatgacaatgatgctgcg
tgggccatgaaggatattgaagcgtttgaagaagcggtgagcgtcgcgtttgattttgcg
gagaaggacgggaataccctcgtcgttgtcgtaggcgaccatgatacgggtggactttcc
gtaggtgcatatggacagtacaaagcaaaacccgatatgctcaaacaagtaaaagcaact
gggaaatttattgccagtcaagtgaacaaacgccggaccaacctagctgacgttatgaaa
acatacactgggtttgagctaacaaaaaaagagctcaaacaaattaaaaaggcggatcac
ttaacgaatgccattaatcaagtcattagcagacgtgcgttgataggatggacgacccct
gttcacacgggaacggatattcctatttatgcgttcgggccttgctctgatcggcttcat
ggattgttagacaacacagacataccactcatcctcgcagatgtgatggatcttgagtgg
gaaaaagcgagctaa

DBGET integrated database retrieval system