KEGG   Bacillus halodurans: BH1093Help
Entry
BH1093            CDS       T00039                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bha  Bacillus halodurans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bha00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178240..1179733
Genome map
AA seq 497 aa AA seqDB search
MTKKYILALDQGTTSSRAILFNEAGEIIGIEQKEFQQIFPKPGWVEHDANEIWASVLSVI
AGVLLKTNVEAKEIAAIGITNQRETAVVWEKESGRPIYNALVWQSRQTAGICERLRAEGF
SEMVTEKTGLLIDPYFSGTKVRWILDHVDGAQERAERGELLFGTIDTWLIWKLSGGKAHV
TDYSNASRTLLYNIYEQCWDDELLKMLNVPRAMLPDVRPSSEVYAETVSYHFFGEEIPIA
GAAGDQQAALFGQACFEKGMAKNTYGTGCFMLMNTGNQGVKSKHGLLTTIAWGLDGKVEY
ALEGSIFVAGSAIQWLRDGLRMMKSAKESEGYATKVTSADGVYVVPAFVGLGTPYWDSDV
RGAVFGLTRGTSKEHFIRATLESLAYQTKDVLQAMEADSGISLKTLRVDGGAVANNFLMQ
FQSDLLGVSVERPTVQETTALGAAYLAGLAVGFWTSKEEITNNWNLEQKFSAEMEETDRA
KLYEGWQKAVRAAQAFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaatacattttagcgctggatcaaggaacaacaagttcacgggcgatctta
tttaatgaagcaggggaaattatcgggattgaacagaaagaatttcagcaaatttttcct
aagcctggctgggtcgagcatgatgcaaacgaaatttgggcatcggtcctgtcggtcatc
gccggtgttttattaaaaacaaatgtagaagcgaaagaaattgccgccattggcattacc
aaccaacgggaaacggcagtagtatgggaaaaagagtccggacgtccaatttacaatgcc
cttgtatggcaatctagacaaacggctggtatttgcgaacgcctaagagcggaagggttt
agtgaaatggtcacggaaaagacaggtcttctcatcgatccgtatttctcaggtacgaaa
gtgcggtggattctcgatcatgtggacggagcacaagaacgagctgaacgaggagagttg
ttgttcggtacgattgatacgtggctcatttggaagttgagcggaggaaaggctcatgtg
accgattattccaatgcgtcgcgaacgttgctctacaatatttatgagcagtgctgggat
gacgaactgttaaagatgctaaatgtaccacgggcgatgcttcctgatgtacgtccttca
tcggaggtgtatgccgagacggtatcctaccatttcttcggggaggaaattccgattgca
ggcgccgcaggagaccagcaagctgcattgtttgggcaggcgtgctttgaaaagggaatg
gcgaaaaatacgtatggtacaggatgcttcatgctaatgaatactggaaaccaaggggtg
aagtcaaagcatgggttgttgacgaccatcgcctggggcctcgacggaaaagtggagtat
gccttagagggaagtatttttgtcgctggctccgcgatccaatggctgcgagacggtctc
agaatgatgaaatcggcgaaggaatcggaaggctatgcaacgaaggtcacatccgctgat
ggggtctatgttgtgccagcatttgtgggccttggaacaccgtattgggattcggatgta
agaggcgccgtcttcggtctgacaagaggaacgtcaaaagagcatttcattcgtgccaca
ctggagtctttagcgtatcaaacaaaagatgtcttgcaggcaatggaagctgattcaggt
atttcattaaaaacgcttcgtgtcgatggtggagcggtggctaataacttccttatgcag
ttccaaagtgatctgctaggggtgtcggtggaacgaccgacagttcaagaaacaacagca
ctcggagcagcttatttagctggtttggctgtcggtttctggacatcaaaagaagaaatt
acgaacaactggaacctagaacagaaattctctgccgaaatggaagaaacggatcgagca
aaactatatgaaggttggcaaaaggctgttcgcgccgcacaagcttttaaataa

DBGET integrated database retrieval system