KEGG   Bacillus halodurans: BH1217Help
Entry
BH1217            CDS       T00039                                 

Gene name
nifS
Definition
NAD biosynthesis
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
bha  Bacillus halodurans
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BH1217 (nifS)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    BH1217 (nifS)
Enzymes [BR:bha01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BH1217 (nifS)
Transfer RNA biogenesis [BR:bha03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    BH1217 (nifS)
 Prokaryotic Type
    BH1217 (nifS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1309062..1310189)
Genome map
AA seq 375 aa AA seqDB search
MIYLDYCATTPMSDYVKDVYVTVASQFYGNPNSLHDVGYEASNILEQCKRQIANLLHIDP
AGIFFTGSASEANFLTIVSLALAHRRKGRHLITTKCEHPSVLSTFRYLESQQFDVSYVPV
NRYGQVSVDALMGTIREDTILVSIAHSQSVLGTIQSLETFAEPLVTYDILFHSDCTQSIG
KVDVPIRQLHSLTMSGHKINGPKGIGLAYVDPAIQWEPFLSGVTQQSGFRQGTVDIPSVA
AFTAAIEESFQHRTAYDQHITKLHHQFKEKMMEWPMILEGHPSNRLKHHFGLRLHGMEGQ
FVMLEANRAGFAISTGTACSSSHHEPDPVFAAIGRTKEEADQFFRVSFGISTTEQEFNAF
IDFLQQLIDRKGEPM
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttatttagattattgtgcaacaacaccaatgtcagactatgtaaaagacgtttat
gtaacggtcgcctcacaattttatggaaatccgaatagcttacacgatgttggctacgaa
gcatcgaacattttagagcaatgcaaacgacaaatcgctaaccttttgcacatagatcca
gcaggaatcttttttaccggttctgcctctgaggccaactttttaacaattgttagcctt
gccctcgcccaccgcaggaaagggaggcatctcattacgacaaaatgcgaacacccttcg
gttttgagcacattccgctatttggaatcccagcagtttgacgtttcgtatgtaccggtg
aacagatacggccaagtgtctgttgatgctcttatggggaccattcgagaggatacaatc
ctcgtctcaatcgctcatagccagagtgttctaggaacgattcaatcgctcgaaaccttt
gccgaaccactagtcacttatgatatacttttccatagcgactgtacccaatcgatcggc
aaagttgatgtcccgattaggcagcttcacagcttaacaatgtcaggacataagatcaat
ggcccaaaagggatcggcctcgcctatgtcgatcctgcgatccaatgggagccttttctt
tctggcgttacccagcaaagtggctttcgccaaggaaccgttgatattcctagtgtcgct
gcctttaccgctgccattgaagagagctttcagcatcggacagcatacgatcaacatatt
acgaaactccatcaccagtttaaagaaaaaatgatggaatggcctatgatcctagaaggt
catccgtccaaccgattgaaacaccattttggcttacggttacatgggatggaaggacaa
tttgtcatgcttgaggcgaaccgagcaggatttgccatctctactggaacggcgtgttct
tcttctcaccatgagcctgatccggtttttgcagcgattggccgaacaaaggaggaagct
gatcagtttttccgtgtcagctttgggataagtacgacggaacaggaatttaatgctttt
attgactttttacaacaattaatcgataggaaaggtgaaccgatgtga

DBGET integrated database retrieval system