KEGG   Bacillus halodurans: BH1217Help
Entry
BH1217            CDS       T00039                                 

Gene name
nifS
Definition
NAD biosynthesis
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
bha  Bacillus halodurans
Pathway
Thiamine metabolism
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:bha00730]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:bha04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1309062..1310189)
Genome map
AA seq 375 aa AA seqDB search
MIYLDYCATTPMSDYVKDVYVTVASQFYGNPNSLHDVGYEASNILEQCKRQIANLLHIDP
AGIFFTGSASEANFLTIVSLALAHRRKGRHLITTKCEHPSVLSTFRYLESQQFDVSYVPV
NRYGQVSVDALMGTIREDTILVSIAHSQSVLGTIQSLETFAEPLVTYDILFHSDCTQSIG
KVDVPIRQLHSLTMSGHKINGPKGIGLAYVDPAIQWEPFLSGVTQQSGFRQGTVDIPSVA
AFTAAIEESFQHRTAYDQHITKLHHQFKEKMMEWPMILEGHPSNRLKHHFGLRLHGMEGQ
FVMLEANRAGFAISTGTACSSSHHEPDPVFAAIGRTKEEADQFFRVSFGISTTEQEFNAF
IDFLQQLIDRKGEPM
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttatttagattattgtgcaacaacaccaatgtcagactatgtaaaagacgtttat
gtaacggtcgcctcacaattttatggaaatccgaatagcttacacgatgttggctacgaa
gcatcgaacattttagagcaatgcaaacgacaaatcgctaaccttttgcacatagatcca
gcaggaatcttttttaccggttctgcctctgaggccaactttttaacaattgttagcctt
gccctcgcccaccgcaggaaagggaggcatctcattacgacaaaatgcgaacacccttcg
gttttgagcacattccgctatttggaatcccagcagtttgacgtttcgtatgtaccggtg
aacagatacggccaagtgtctgttgatgctcttatggggaccattcgagaggatacaatc
ctcgtctcaatcgctcatagccagagtgttctaggaacgattcaatcgctcgaaaccttt
gccgaaccactagtcacttatgatatacttttccatagcgactgtacccaatcgatcggc
aaagttgatgtcccgattaggcagcttcacagcttaacaatgtcaggacataagatcaat
ggcccaaaagggatcggcctcgcctatgtcgatcctgcgatccaatgggagccttttctt
tctggcgttacccagcaaagtggctttcgccaaggaaccgttgatattcctagtgtcgct
gcctttaccgctgccattgaagagagctttcagcatcggacagcatacgatcaacatatt
acgaaactccatcaccagtttaaagaaaaaatgatggaatggcctatgatcctagaaggt
catccgtccaaccgattgaaacaccattttggcttacggttacatgggatggaaggacaa
tttgtcatgcttgaggcgaaccgagcaggatttgccatctctactggaacggcgtgttct
tcttctcaccatgagcctgatccggtttttgcagcgattggccgaacaaaggaggaagct
gatcagtttttccgtgtcagctttgggataagtacgacggaacaggaatttaatgctttt
attgactttttacaacaattaatcgataggaaaggtgaaccgatgtga

DBGET integrated database retrieval system