KEGG   Bacillus halodurans: BH1224Help
Entry
BH1224            CDS       T00039                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bha  Bacillus halodurans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BH1224 (ruvA)
Enzymes [BR:bha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BH1224 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1317241..1317852
Genome map
AA seq 203 aa AA seqDB search
MIDYLRGTLTDIDHQYAVVEVHGVGYQVYCPNPYEFEKERDSVITIYTFQYVREDVIRLY
GFRTKEKRSLFEKLLNVSGIGPKGALAILATGQPEHVIQAIEEEDEAFLVKFPGVGKKTA
RQIILDLKGKVDELHPGLFSQKEEQPKPHEKNDGNQALDEAMEALKALGYVEKELKKVKP
KLEQETLTTDAYIKKALQLMLNR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattgattacttgcgaggaacattaacggatattgaccatcaatatgccgtcgttgag
gttcatggggtgggttatcaagtgtattgcccaaacccatatgagtttgaaaaagaacgg
gattccgtgatcaccatttatacattccaatatgttcgagaagatgtgatccgcttatat
ggttttcggacaaaggaaaagcgttcattgtttgagaagcttttaaatgtttcaggcata
ggaccgaaaggagcacttgccattttagctactggtcaaccggagcatgtcatacaggcg
attgaagaggaagatgaggcctttttagtcaagtttcctggcgtaggaaagaaaacagcc
cgacaaatcatccttgatttaaaaggaaaagtggatgaattgcacccaggtcttttctct
cagaaggaagagcagccaaaacctcatgaaaaaaacgatgggaaccaggctctcgatgag
gcgatggaggcgctaaaagcactagggtatgtggaaaaagagcttaagaaagtgaagcca
aaactcgagcaggaaacgttaacgaccgatgcgtatattaaaaaagcattgcagcttatg
ttgaaccgctaa

DBGET integrated database retrieval system